SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30026
         (796 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_24957| Best HMM Match : Terminase_4 (HMM E-Value=2.7)               29   5.7  
SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27)                    28   7.6  

>SB_24957| Best HMM Match : Terminase_4 (HMM E-Value=2.7)
          Length = 354

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 17/68 (25%), Positives = 29/68 (42%)
 Frame = -3

Query: 593 FLTPTRSDKYVKTSVAGPPIMNPLMVLAAAEVCSLERCFGLKLSLHPGATSSLGCSSCRR 414
           FL   ++D Y+ T     P   P +     E+          L +   A+ S+GC+SC+R
Sbjct: 251 FLNTPKNDDYIATEAT--PFTVPAVQHNEMEISKFSTVTATVLGVQK-ASRSIGCTSCQR 307

Query: 413 HRPLYPRR 390
              + P +
Sbjct: 308 QTVVTPNK 315


>SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27)
          Length = 770

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = -1

Query: 742 PGKEQPPRSKLARALDSPGF*MESPSRRVQAKVTRPQQNS 623
           P  + PP + L RALD+ G     P RR+   +TR  Q++
Sbjct: 714 PKAKLPPNNSLFRALDASGPVSRGPDRRM-PDITRANQSA 752


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,639,089
Number of Sequences: 59808
Number of extensions: 646966
Number of successful extensions: 1571
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1450
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1569
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2191792647
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).