SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30025
         (734 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_57256| Best HMM Match : Cation_ATPase_C (HMM E-Value=3.2)           31   1.3  
SB_34390| Best HMM Match : PMT (HMM E-Value=4.5)                       29   3.9  
SB_3534| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   9.0  

>SB_57256| Best HMM Match : Cation_ATPase_C (HMM E-Value=3.2)
          Length = 450

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = -1

Query: 533 VVSRLCLNLHK*KVYIPGVIFFNSHEFLNFIPNKGKVRYVFFPIFN*YQNIFYYSNII 360
           +V+ +CL L    ++   ++ F    + NF    G  +++ +P F  YQ  FYY+ I+
Sbjct: 203 LVTNICLALASLDIFFVILVDFQWDAYFNF---HGVHKFMHYPEFRGYQRGFYYAYIV 257


>SB_34390| Best HMM Match : PMT (HMM E-Value=4.5)
          Length = 537

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = -2

Query: 661 HGFLFTQVLMSLSYRTNKS--GIMFQAFINTISVRRK 557
           HG +FT V+  LSY+T +   G +F   ++ +S + K
Sbjct: 445 HGVVFTTVVSDLSYKTKRGLHGAVFTTAVSDLSYKTK 481



 Score = 28.7 bits (61), Expect = 5.2
 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = -2

Query: 661 HGFLFTQVLMSLSYRTNKS--GIMFQAFINTISVRRK 557
           HG +FT     LSY+T +   G++F   ++ +S + K
Sbjct: 425 HGVVFTTAASDLSYKTKRGLHGVVFTTVVSDLSYKTK 461


>SB_3534| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 206

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -3

Query: 669 SNDMVSFSHK-SLCHCRIEPINLESCFKHL*ILFQLGERAIDSLNMCR 529
           S+DMV ++H+   CH ++ P    +   HL  +    ERA+D+L + R
Sbjct: 129 SDDMVDWAHRYEACH-KLFPRITPADLTHLIDVMTFSERAVDTLQLER 175


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,956,322
Number of Sequences: 59808
Number of extensions: 404357
Number of successful extensions: 795
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 683
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 795
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1974037988
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).