SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30024
         (540 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0)               56   2e-08
SB_19342| Best HMM Match : Keratin_B2 (HMM E-Value=0.41)               29   3.2  
SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08)                   27   7.4  
SB_25219| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.4  
SB_52232| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.8  

>SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0)
          Length = 112

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 29/52 (55%), Positives = 34/52 (65%), Gaps = 2/52 (3%)
 Frame = +3

Query: 357 PFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKH-FNDD-YFKKNKKCVKRT 506
           PF  N  PLRRIPQ YVI TST I + + KLP+H F D+ YFK   K  KR+
Sbjct: 2   PFKINGVPLRRIPQSYVIATSTHIDVSDVKLPEHAFADESYFKGEPKKKKRS 53


>SB_19342| Best HMM Match : Keratin_B2 (HMM E-Value=0.41)
          Length = 1093

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 1/62 (1%)
 Frame = +3

Query: 216 PSIQQACTQDPTQLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSC-PLRRI 392
           P  +   T  P   KI T    +  RH+   V     L +G+ +      F SC P +RI
Sbjct: 72  PRYENMLTSKPDTTKIATSRTEVTPRHSENHVSNALTLKTGISITRNMQTFKSCTPAQRI 131

Query: 393 PQ 398
           P+
Sbjct: 132 PR 133


>SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08)
          Length = 593

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%)
 Frame = +2

Query: 173 PSTPLRRKSVLHLVAVHSASMYAGSDPT-EDRNC 271
           P TPL   ++    ++  A + AG+DP   DRNC
Sbjct: 493 PPTPLHLAAITKQASLVQALLEAGADPNLTDRNC 526


>SB_25219| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 12/49 (24%), Positives = 23/49 (46%)
 Frame = +2

Query: 140 EPEQYPSNVGSPSTPLRRKSVLHLVAVHSASMYAGSDPTEDRNCLHSPR 286
           EP ++P +  +P  PL+ +  L L + H+    +  D    +  L + R
Sbjct: 55  EPSEFPQDTQNPQIPLQTRRTLRLPSRHAEPSDSPPDTQNPQTSLQTRR 103


>SB_52232| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 929

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 10/29 (34%), Positives = 14/29 (48%)
 Frame = +3

Query: 183 HSGENPCFIWWPSIQQACTQDPTQLKIGT 269
           H G + C  W+P +   C   P  L +GT
Sbjct: 567 HLGNHHCMSWYPEVSHHCPNTPIVL-VGT 594


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,905,153
Number of Sequences: 59808
Number of extensions: 348712
Number of successful extensions: 959
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 845
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 940
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1227799733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).