SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30023
         (770 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.)              70   2e-12
SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.)              53   3e-07
SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45)           40   0.003
SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23)             40   0.003
SB_47003| Best HMM Match : Mito_carr (HMM E-Value=2.3e-29)             36   0.048
SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0)                   34   0.11 
SB_27933| Best HMM Match : Mito_carr (HMM E-Value=6.9e-17)             34   0.15 
SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0)                   32   0.45 
SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0)                   31   0.78 
SB_51922| Best HMM Match : Mito_carr (HMM E-Value=0)                   31   1.0  
SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0)                    31   1.0  
SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34)             30   1.8  
SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0)                   30   1.8  
SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13)              30   1.8  
SB_13327| Best HMM Match : Viral_cys_rich (HMM E-Value=8.3)            29   5.5  
SB_41780| Best HMM Match : Mito_carr (HMM E-Value=3.9e-05)             29   5.5  
SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0)                   28   7.3  

>SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 304

 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 35/72 (48%), Positives = 45/72 (62%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP DT+RRRMMM SG A   + YK +I C   I K EG     KGA +N+LRG  GA
Sbjct: 227 LASYPIDTIRRRMMMTSGEA---VKYKGSIDCTIQILKKEGAMSLMKGAGANILRGMAGA 283

Query: 181 FVLVLYDEIKKV 216
            VL  +D+ K++
Sbjct: 284 GVLAGFDKFKEL 295



 Score = 28.3 bits (60), Expect = 7.3
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = +1

Query: 40  MMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           M+++GR   D  YK  I C +   ++EG   F++G  +N +R
Sbjct: 43  MLKAGRL--DHPYKGVIDCTSRTYRSEGFLSFWRGNLANCIR 82


>SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 262

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 24/53 (45%), Positives = 35/53 (66%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +YP D VRRRM M+  RA  D  YK+T+H +++I K EG    +KG + N+L+
Sbjct: 179 TYPLDVVRRRMQMKGIRA--DFAYKSTLHAFSSIVKLEGFRGLYKGMWPNILK 229


>SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45)
          Length = 773

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +YP D VRRRM M+ G       Y +T   +  I ++EG    FKG + N+L+
Sbjct: 699 TYPLDVVRRRMQMERGEGM--FKYSSTWDGFKVIVRSEGFIGLFKGMWPNLLK 749


>SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23)
          Length = 1026

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 16/51 (31%), Positives = 28/51 (54%)
 Frame = +1

Query: 10   YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
            YP D V+ RM  Q    +++ +YKN+I C+  + + EG    ++G    +L
Sbjct: 932  YPIDLVKTRMQNQRAVLEAEKVYKNSIDCFFKVVRNEGPIGLYRGLLPQLL 982


>SB_47003| Best HMM Match : Mito_carr (HMM E-Value=2.3e-29)
          Length = 868

 Score = 35.5 bits (78), Expect = 0.048
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 3/75 (4%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSD--ILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG-TG 174
           I  P D  + +M +Q  RA+S   I Y+N  H   TIA+T G    ++G  + ++R    
Sbjct: 218 IEGPIDLFKSKMQVQIIRAQSGAPIQYRNVFHAGYTIAQTYGIRGCYQGLSATLVRNIPA 277

Query: 175 GAFVLVLYDEIKKVL 219
             F    Y+  K +L
Sbjct: 278 NGFFFGFYEFTKNLL 292


>SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 328

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMM-MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           ++ +P DT++ R+  M   +     +YKN+  C+  I + EG    F+G    +L     
Sbjct: 54  LVGFPLDTIKVRLQAMPLPKPGEPWMYKNSFDCFFKIIRNEGVYYLFRGVTVPILNSIPN 113

Query: 178 AFVL 189
             VL
Sbjct: 114 TTVL 117


>SB_27933| Best HMM Match : Mito_carr (HMM E-Value=6.9e-17)
          Length = 187

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 3/49 (6%)
 Frame = +1

Query: 13  PFDTVRRRMMMQS---GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAF 150
           P + V+ RM +Q     R    + Y+N  H   TIAK EG     KG F
Sbjct: 24  PLEVVKTRMQLQGELKSRGTYSVYYRNVFHASYTIAKYEGILAMQKGLF 72


>SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 375

 Score = 32.3 bits (70), Expect = 0.45
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 3/62 (4%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG---AFSNVLRGTGGA 180
           YP + ++ R+ +Q    KS+  YK   H   TI + EG    +KG   +F  +    GG+
Sbjct: 171 YPCEVIKTRLTVQHVN-KSNAHYKGMRHALKTILREEGILALYKGVTPSFLGLFPFAGGS 229

Query: 181 FV 186
           F+
Sbjct: 230 FL 231


>SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 274

 Score = 31.5 bits (68), Expect = 0.78
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           ++PFD ++ R+       K    YK  + C     K EG   F +G +  +LRG
Sbjct: 150 TFPFDVIKSRIQADGNLGK--FRYKGMMDCALQSYKEEGMIVFTRGIWPTLLRG 201


>SB_51922| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 200

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEG-TSPFFKGAFSNVLRGTGG- 177
           ++YP D VRRRM + +G       Y   I+ + ++   +G     ++G   N LR     
Sbjct: 123 LAYPLDVVRRRMQL-AGTVADGHKYSTCINTFISVYTEDGIRRGLYRGLSINYLRVCPQV 181

Query: 178 AFVLVLYDEIKKVL 219
           A +  +Y+ +K++L
Sbjct: 182 AVMFAVYEVVKQLL 195


>SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 276

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 1/56 (1%)
 Frame = +1

Query: 46  QSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV-LYDEIK 210
           Q  R   D  Y+  +    T+ KTEG    +KG    + R    A + + LYD++K
Sbjct: 56  QGVRTTHDAHYRGMLGTMVTLFKTEGMKTMYKGLIPGIHRQLCFASIRIGLYDQVK 111


>SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34)
          Length = 302

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 14/50 (28%), Positives = 25/50 (50%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           P D ++ R+ + + R + +  Y   I C   I   EG + F+KGA   ++
Sbjct: 225 PLDVIKTRLQLLN-RPQGEPNYNGIIDCAKKIYSNEGLAAFYKGAVPRMI 273


>SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 264

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 1/55 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEG-TSPFFKGAFSNVLR 165
           I+YP D VRRRM + +G       Y   I+    + K +G     ++G   N LR
Sbjct: 189 IAYPLDVVRRRMQL-AGAVPDGHKYNTCINTLVNVYKDDGIRRGLYRGLSINYLR 242


>SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13)
          Length = 577

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           YP + ++ R+ +Q    KS+  YK   H   TI + EG    +KG   + L
Sbjct: 440 YPCEVIKTRLTVQHVN-KSNAHYKGMRHALKTILREEGILALYKGVTPSFL 489


>SB_13327| Best HMM Match : Viral_cys_rich (HMM E-Value=8.3)
          Length = 321

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 12/21 (57%), Positives = 16/21 (76%)
 Frame = -1

Query: 191 TSTKAPPVPLRTLEKAPLKKG 129
           TST++ P P +TLEKA +K G
Sbjct: 27  TSTQSHPEPYKTLEKATVKSG 47


>SB_41780| Best HMM Match : Mito_carr (HMM E-Value=3.9e-05)
          Length = 383

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 12/60 (20%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL------------YKNTIHCWATIAKTEGTSPFFKG 144
           +I YPF+TV  R+ +Q  R   D L            Y + + C+ TI + EG   F++G
Sbjct: 290 LILYPFETVLHRLYIQGTRTIIDDLDNAADVIPLSTNYFSMLDCFRTIYQQEGIFGFYRG 349


>SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 306

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-GA 180
           I+ P D V+ R   Q+ +    I YKN  H +  IAK EG    + G    V R      
Sbjct: 131 IATPTDLVKIRF--QAVKIGETIPYKNMFHAFYKIAKKEGFLGLWTGMKPTVKRAACISG 188

Query: 181 FVLVLYDEIKKVL 219
             +  YD  K +L
Sbjct: 189 TQIPTYDHTKHLL 201


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,302,563
Number of Sequences: 59808
Number of extensions: 395858
Number of successful extensions: 721
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 654
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 718
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2095976575
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).