SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30022
         (834 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.50 
SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.0  
SB_52793| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_57666| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.1  
SB_10132| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.1  

>SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 795

 Score = 32.3 bits (70), Expect = 0.50
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = -2

Query: 833 PPEVRPPKSFRPKSLRPKSTAQSPRPIAP 747
           PP+  PP S  P ++ P S++  PRP  P
Sbjct: 734 PPDESPPSSKHPPTVSPSSSSAPPRPSTP 762


>SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 771

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 6/71 (8%)
 Frame = +1

Query: 1   LSHRNISKVGVVLIGY*INYHRV--SSKRISL----VSSKHKMRAFVVLACVAMAYGRPE 162
           +SH  +  + + +IGY  +YHRV   S  I L    +SS H++  F+ L       G P 
Sbjct: 637 VSHFLLLGIPLRIIGYPTSYHRVVFLSSGIPLPIIGLSSYHRVSHFLSLGIPLPIIGIPL 696

Query: 163 PPVGYSYSAPR 195
           P +GY  S  R
Sbjct: 697 PIIGYPTSYHR 707


>SB_52793| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 532

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = +3

Query: 375 ASEVMLDSVADMRVDTLVLLLYRNTSMFTYLPQNQLSKDFLVSL 506
           A +V  +   D++V  L  LL  NTSMF+   QN +SK  ++ L
Sbjct: 266 ARKVFTNKTQDIKVSKLTRLLVANTSMFS---QNLVSKSAVIKL 306


>SB_57666| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 382

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 11/38 (28%), Positives = 16/38 (42%)
 Frame = +2

Query: 653 PDIIIPNSSTHFSPSKPEVYFHQISNPKGIWLVLLAGG 766
           P I++P +  HF     ++       P   WLVL   G
Sbjct: 336 PSILVPRAINHFRLCSAKILIVPFGKPAAFWLVLCPDG 373


>SB_10132| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 101

 Score = 28.3 bits (60), Expect = 8.1
 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 4/45 (8%)
 Frame = +2

Query: 182 TPLPEVTQEA-SALPLSAADTELLLWWS---FWIPRWPFWRQHFP 304
           TPLP  T  + +  P    DT +  W +   +W P  P+W  + P
Sbjct: 29  TPLPYWTPHSLTRHPYPLLDTHIPYWTAHIPYWTPYLPYWTPYLP 73


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,507,551
Number of Sequences: 59808
Number of extensions: 391264
Number of successful extensions: 1476
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1309
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1475
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2347493764
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).