SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30019
         (719 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_36095| Best HMM Match : DMP1 (HMM E-Value=3.2)                      40   0.003
SB_57270| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.54 
SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011)             31   0.71 
SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.94 
SB_49936| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.94 
SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053)                 31   1.2  
SB_55591| Best HMM Match : TIL (HMM E-Value=4.2e-09)                   30   2.2  
SB_42263| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.0  
SB_3877| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.0  
SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.0  
SB_48810| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.0  
SB_59250| Best HMM Match : Sulfatase (HMM E-Value=1.2e-26)             28   6.6  
SB_16975| Best HMM Match : MFS_1 (HMM E-Value=2.6e-24)                 28   6.6  
SB_24966| Best HMM Match : Sulfatase (HMM E-Value=9e-39)               28   6.6  
SB_14763| Best HMM Match : Zona_pellucida (HMM E-Value=0)              28   6.6  

>SB_36095| Best HMM Match : DMP1 (HMM E-Value=3.2)
          Length = 939

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 1/59 (1%)
 Frame = +3

Query: 135  PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESV 308
            PA AP   A+   YP  +P  P  VPG P+  P  P  VPG P      P +  +  SV
Sbjct: 869  PAQAPGYPAQAPGYPAQVPGYPAQVPGYPAQAPGCPAQVPGYPAQVPGYPAQVPAGSSV 927



 Score = 37.9 bits (84), Expect = 0.008
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = +3

Query: 111  FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVP-GAPVAYHTSPL 284
            +P      PA  P   A+   YP   P  P  VPG P+ +P  P  VP G+ V Y +SP 
Sbjct: 875  YPAQAPGYPAQVPGYPAQVPGYPAQAPGCPAQVPGYPAQVPGYPAQVPAGSSVQYVSSPQ 934

Query: 285  RY 290
            ++
Sbjct: 935  QF 936


>SB_57270| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 427

 Score = 31.9 bits (69), Expect = 0.54
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP--LRYSSAESVSSQNIVRHDQPQT 347
           P ++   PC+V   P  +   PC+V  +P     SP  +++S      S   V+H  P T
Sbjct: 103 PYTVQHSPCTVQHSPYTVQHSPCTVQHSPYTVQHSPYTVQHSPYAVQHSPYTVQH-SPYT 161

Query: 348 IQY 356
           +Q+
Sbjct: 162 VQH 164


>SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011)
          Length = 812

 Score = 31.5 bits (68), Expect = 0.71
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = +3

Query: 147 PRC-QARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQ 317
           P C Q RCC   ++P+GP   P  P  + + P  +P AP+    +P+    A     Q
Sbjct: 441 PICIQHRCCN-ANMPQGPPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQ 497



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 2/37 (5%)
 Frame = +3

Query: 135 PASAPRCQARCC--YPCSLPRGPCSVPGRPSCLPRGP 239
           P+ AP     CC  YP   P  P + P +P+  PR P
Sbjct: 507 PSCAPTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRSP 543


>SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1530

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 16/64 (25%), Positives = 26/64 (40%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYS 293
           P+ C+   +    C ++C   C  P G   +  R  C+  G CS   + + Y    +R S
Sbjct: 770 PRDCSNMNSDPNACNSKCVDGCFCPEG--KIQDRGKCVDPGQCSCYHSGIPYAHGAIRKS 827

Query: 294 SAES 305
              S
Sbjct: 828 ECSS 831


>SB_49936| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 526

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 5/54 (9%)
 Frame = +3

Query: 147 PRCQAR--CCY---PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYS 293
           PRC     C Y   PC     PC    RP C    PC     P  Y   P RY+
Sbjct: 183 PRCYTLRPCRYMLRPCRYMLRPCRYMLRPCCYTLRPCRYMLRPCRYTLRPCRYT 236



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/39 (35%), Positives = 14/39 (35%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRY 290
           PC     PC    RP C    PC     P  Y   P RY
Sbjct: 169 PCRYTLRPCRYTLRPRCYTLRPCRYMLRPCRYMLRPCRY 207



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%)
 Frame = +3

Query: 165 CCY---PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYS 293
           CCY   PC     PC    RP      PC     P  Y   P RY+
Sbjct: 212 CCYTLRPCRYMLRPCRYTLRPCRYTLRPCRYTLRPCRYTLRPCRYT 257


>SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053)
          Length = 1152

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 16/36 (44%), Positives = 19/36 (52%)
 Frame = +3

Query: 171 YPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTS 278
           YP    + PC +P   SC P+ PCS PG    Y TS
Sbjct: 736 YPPYTGQVPC-LPS--SCTPQNPCSPPGCTPQYSTS 768


>SB_55591| Best HMM Match : TIL (HMM E-Value=4.2e-09)
          Length = 133

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/64 (23%), Positives = 26/64 (40%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYS 293
           P+ C+   +    C ++C   C  P G   +  R  C+  G CS   + + Y    +R +
Sbjct: 71  PRDCSNMNSDPNACNSKCVDGCFCPEG--KIQDRGKCVDPGQCSCYHSGIPYAHGAIRKT 128

Query: 294 SAES 305
              S
Sbjct: 129 ECSS 132


>SB_42263| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 440

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = -1

Query: 578 YLLLGLVIARSDHQLLSSCTRTWVGNLLSLVSYDF 474
           YL   LVI R D  LL  C   +V + LS +  DF
Sbjct: 296 YLAAALVIHRRDDVLLGECDMAFVHHSLSKIPSDF 330


>SB_3877| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 10/27 (37%), Positives = 13/27 (48%)
 Frame = +3

Query: 171 YPCSLPRGPCSVPGRPSCLPRGPCSVP 251
           + C LP   C +P    CLP   C +P
Sbjct: 27  HKCGLPYNECGLPYNKCCLPYTNCGLP 53


>SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1434

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = +3

Query: 171 YPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHT 275
           YP    + PC +P   SC P+ PCS PG    Y T
Sbjct: 255 YPPYTGQIPC-LPS--SCAPQNPCSPPGCTPQYST 286


>SB_48810| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 1/40 (2%)
 Frame = +3

Query: 66  TSGCSRALLSR*SRFFPK-HCAP*PASAPRCQARCCYPCS 182
           TS  SRA L     F P  HCA    S PRC AR   P S
Sbjct: 18  TSPLSRAALRAYKAFHPVLHCALYKCSTPRCIARYTSPPS 57


>SB_59250| Best HMM Match : Sulfatase (HMM E-Value=1.2e-26)
          Length = 431

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 14/38 (36%), Positives = 15/38 (39%)
 Frame = +3

Query: 207 PGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQN 320
           PG   CL  G C   G  V  H  PL Y      S +N
Sbjct: 338 PGSEMCLGDGVCRCYGEDVNVHDPPLLYDITADPSEKN 375


>SB_16975| Best HMM Match : MFS_1 (HMM E-Value=2.6e-24)
          Length = 1193

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = -3

Query: 663 FSRCTSTVLIEPVSFVERV*TLYYITXRVPLVG 565
           F RC +T + + V+ V+R   LYY T R  L G
Sbjct: 748 FMRCATTAISQNVNLVQRGTKLYYETSRDVLQG 780


>SB_24966| Best HMM Match : Sulfatase (HMM E-Value=9e-39)
          Length = 671

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 14/38 (36%), Positives = 15/38 (39%)
 Frame = +3

Query: 207 PGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQN 320
           PG   CL  G C   G  V  H  PL Y      S +N
Sbjct: 564 PGSEMCLGDGVCRCYGEDVNVHDPPLLYDITADPSEKN 601


>SB_14763| Best HMM Match : Zona_pellucida (HMM E-Value=0)
          Length = 689

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%)
 Frame = +3

Query: 138 ASAPRCQARCCY--PCSLPRGPCSVPGRPSCLPRGPC 242
           AS  +  A C Y  PCS   G CSV G  +C    PC
Sbjct: 2   ASCLQVTATCSYGNPCS-NGGSCSVDGSETCSNSNPC 37


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,125,516
Number of Sequences: 59808
Number of extensions: 340810
Number of successful extensions: 996
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 779
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 980
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1913853903
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).