SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30015
         (660 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85)             30   1.9  
SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34)              29   4.4  
SB_42005| Best HMM Match : Myosin_head (HMM E-Value=0)                 28   5.9  
SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24)           28   5.9  
SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.7  

>SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 79

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 15/27 (55%), Positives = 22/27 (81%)
 Frame = +2

Query: 260 MIPHKTERGKNALRRLRTYDGCPPPFD 340
           MIPHKT++G  A+ R++ +DG PPP+D
Sbjct: 1   MIPHKTKKGTEAMNRMKVFDGVPPPYD 27


>SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85)
          Length = 1459

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = +1

Query: 28  SMAVVICWAVWRQSSPRSFSKGTKLLWFAANKSIFLATSLG 150
           SM+V +C ++W  + P  F    +L+W+  + S+  + SLG
Sbjct: 265 SMSVSLCQSIWYHTHPSVFVSLGQLIWYNTHPSV--SVSLG 303


>SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34)
          Length = 225

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 10/37 (27%), Positives = 20/37 (54%)
 Frame = -3

Query: 205 RAGFTLHLLRRNDISLSLFLKKLPEILICSQRTTTTL 95
           R G+   + + ++ ++ LFL   PE++    R TT +
Sbjct: 131 RGGYNCSVCKTSEAAMELFLNNQPEVIFIDMRDTTPI 167


>SB_42005| Best HMM Match : Myosin_head (HMM E-Value=0)
          Length = 621

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/53 (28%), Positives = 28/53 (52%)
 Frame = -3

Query: 259 ASTVFHRILDGALKWKGPRAGFTLHLLRRNDISLSLFLKKLPEILICSQRTTT 101
           A++  H +   AL+W+G R  FTL +   + + LS  + K  + + C   ++T
Sbjct: 525 ATSCEHEVWYQALRWRGERVYFTLIMPWMSRVPLSQPIPKRSDRVSCGALSST 577


>SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24)
          Length = 676

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = -2

Query: 404 IYGQVLDRRHVEQQALQHVDGYQREEGTH-HMY 309
           ++ +VL ++H+E +A  H   Y R +  H H+Y
Sbjct: 323 VFRRVLHQKHIEVEAYNHPHVYSRVKSNHPHVY 355


>SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 168

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 12/57 (21%)
 Frame = +3

Query: 24  VIDGRGHLLGRLAAVIAKVLL------------EGNKVVVVRCEQINISGNFFRNKL 158
           +IDGR  + GRLA  I ++L              G+ VVV+  + I +SG  + NKL
Sbjct: 20  LIDGRDQICGRLAGYIGQILQGKTKPIYHHAEDVGDYVVVINTKHIVLSGTKWDNKL 76


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,455,980
Number of Sequences: 59808
Number of extensions: 439599
Number of successful extensions: 1098
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1037
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1096
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1693527500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).