SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30014
         (611 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)                      147   5e-36
SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)             144   4e-35
SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)                       122   3e-28
SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)                      105   2e-23
SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   8e-22
SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)                 38   0.008
SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06)        34   0.10 
SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06)          34   0.10 
SB_26267| Best HMM Match : TSP_C (HMM E-Value=0)                       30   1.3  
SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)              30   1.3  
SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30)        29   2.2  
SB_29552| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.2  
SB_2785| Best HMM Match : ATP-synt_F (HMM E-Value=0.15)                29   2.2  
SB_51308| Best HMM Match : ATP-synt_F (HMM E-Value=0.14)               29   2.2  
SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.2  
SB_34145| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.2  
SB_48890| Best HMM Match : DUF560 (HMM E-Value=5.2)                    29   3.0  
SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017)                29   3.0  
SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26)                 29   3.9  
SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   5.2  
SB_37567| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.2  
SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0)               28   6.9  
SB_35714| Best HMM Match : Vicilin_N (HMM E-Value=5)                   27   9.1  

>SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1097

 Score =  147 bits (357), Expect = 5e-36
 Identities = 78/142 (54%), Positives = 98/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQVFEGER+MT  NNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 433 YSDNQPGVLIQVFEGERSMTAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ IQ +  +     S  
Sbjct: 493 VDKSTGKENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSM- 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            +T+ED+K+K+KI    DK+ I
Sbjct: 552 KSTVEDDKVKDKI-SEEDKKAI 572


>SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 746

 Score =  144 bits (350), Expect = 4e-35
 Identities = 74/148 (50%), Positives = 99/148 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQ  VLIQV+EGER++TKDNNLLGKFEL+GIPPAPRGVPQI+VTFD+D+NGILNVSA
Sbjct: 525 YSDNQTSVLIQVYEGERSLTKDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSA 584

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +      +E IQ +  +     S  
Sbjct: 585 VDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSM- 643

Query: 407 SATMEDEKLKEKILLNSDKQTIPRTSAT 490
            +TMEDEK+K+K+  +  ++ I R  AT
Sbjct: 644 KSTMEDEKVKDKLSEDEREKVISRCKAT 671


>SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 640

 Score =  122 bits (293), Expect = 3e-28
 Identities = 69/142 (48%), Positives = 87/142 (61%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQP V I+VFEGER +TK NNLLGKF+L+GIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 432 YSDNQPAVTIRVFEGERPLTKHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSA 491

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K     +   K    ++     +      ++    Q+E I  +  +        
Sbjct: 492 KDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVK 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA + +  L+ K L  SDK T+
Sbjct: 552 SA-ISEPSLEGK-LSQSDKDTV 571


>SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1327

 Score =  105 bits (253), Expect = 2e-23
 Identities = 65/142 (45%), Positives = 85/142 (59%), Gaps = 1/142 (0%)
 Frame = +2

Query: 50   SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
            +DNQ  V IQVFEGER MTKDN+ LGKF+L GIPPAPRGVPQIEVTF+ID NGIL VSA 
Sbjct: 1127 ADNQNTVTIQVFEGERPMTKDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAE 1186

Query: 230  EKST-NKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +K T NKE  +       ++P     +    ++  +    + KE ++ +  +     S  
Sbjct: 1187 DKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFAD-EDKKTKEKVEARNELESYAYSLK 1245

Query: 407  SATMEDEKLKEKILLNSDKQTI 472
            +   + EKL  K L   DK+TI
Sbjct: 1246 NQVGDKEKLGGK-LSEDDKKTI 1266


>SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 766

 Score =  100 bits (240), Expect = 8e-22
 Identities = 46/69 (66%), Positives = 56/69 (81%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I+VF+GER M  DN LLG+F+L GIPPAPRGVPQ+EVTFDIDANGI+NVSA 
Sbjct: 238 ADGQTQVEIKVFQGEREMAIDNKLLGQFQLVGIPPAPRGVPQVEVTFDIDANGIVNVSAR 297

Query: 230 EKSTNKENR 256
           +K T +E +
Sbjct: 298 DKGTGREQQ 306



 Score = 35.1 bits (77), Expect = 0.045
 Identities = 16/35 (45%), Positives = 20/35 (57%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK+ IE M+ EAEKY   D + K
Sbjct: 304 EQQIVIQSSGGLSKDAIENMIKEAEKYAEADKQKK 338


>SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)
          Length = 212

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFEL 139
           +D Q  V I+VF+GER M  DN LLG+F+L
Sbjct: 183 ADGQTQVEIKVFQGEREMAIDNKLLGQFQL 212


>SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06)
          Length = 348

 Score = 33.9 bits (74), Expect = 0.10
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = +1

Query: 229 REVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNE 339
           +E+ +  EQ+T   D G +  EE++R+ NE EK +NE
Sbjct: 118 KEIVKLREQLTSKADYGNIHAEELQRIRNELEKCKNE 154


>SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06)
          Length = 364

 Score = 33.9 bits (74), Expect = 0.10
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = +1

Query: 229 REVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNE 339
           +E+ +  EQ+T   D G +  EE++R+ NE EK +NE
Sbjct: 118 KEIVKLREQLTSKADYGNIHAEELQRIRNELEKCKNE 154


>SB_26267| Best HMM Match : TSP_C (HMM E-Value=0)
          Length = 2996

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 13/19 (68%), Positives = 13/19 (68%)
 Frame = +3

Query: 225  LSRSPPTRRTDHHYQRQRS 281
            LSR  P  R DHHY RQRS
Sbjct: 2108 LSRVTPLFRPDHHYNRQRS 2126


>SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)
          Length = 783

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 15/46 (32%), Positives = 26/46 (56%)
 Frame = +1

Query: 211 PQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           P +   +++ QQ EQ+ +  ++ R ++EE  R   EAE  R E D+
Sbjct: 425 PNKALVKQMQQQLEQLKLEEERQRQAEEEKIRQREEAEARRLEKDR 470


>SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30)
          Length = 3071

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +1

Query: 226  YREVHQQGEQITITNDKGRLSKEEIERMVNEAE-KYRNEDDKAKG 357
            Y +  +Q  +I + N+  + SKE++ER V  AE + R+ D + KG
Sbjct: 1030 YDKTRRQLNKILVENENLKGSKEDLERRVVVAENRLRDTDSEMKG 1074


>SB_29552| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 339

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = +2

Query: 80  VFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKE 250
           +FE   ++ + + + G  EL   PPA   V ++E +F+   +G+++    + S+ +E
Sbjct: 125 IFEPRESVPRQSQVPGAMELLPPPPAVFNVNEVETSFEELKSGLMSSGNSDMSSLEE 181


>SB_2785| Best HMM Match : ATP-synt_F (HMM E-Value=0.15)
          Length = 379

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = +1

Query: 277 GRLSKEEIERMVNEAEKYRNEDDKAKGDH-PGPRMHWNLTGFSMK 408
           GR+S EE   ++ E E+Y    D  +  H P PR   +  G S+K
Sbjct: 313 GRISDEEFRLILKEQERYNTLKDAIRARHGPAPRDEKSGKGPSLK 357


>SB_51308| Best HMM Match : ATP-synt_F (HMM E-Value=0.14)
          Length = 246

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = +1

Query: 277 GRLSKEEIERMVNEAEKYRNEDDKAKGDH-PGPRMHWNLTGFSMK 408
           GR+S EE   ++ E E+Y    D  +  H P PR   +  G S+K
Sbjct: 157 GRISDEEFRLILQEQERYNTLKDAIRARHGPAPRDEKSGKGPSLK 201


>SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1353

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = +2

Query: 290  RKRSSVWLMRQRSTETRMTRQKETIQGQECIGIL 391
            R+    W  R +ST TR    K  +QG +CI +L
Sbjct: 1120 RRDGYTWKKRTKSTTTREDHFKLKVQGIDCISVL 1153


>SB_34145| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 679

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 22/75 (29%), Positives = 36/75 (48%)
 Frame = +2

Query: 131 FELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVW 310
           FE+ GI P  +     + + D  +N   NVS+ EKS   + + P  TT +   ++RS   
Sbjct: 157 FEMLGISPEKKD----KDSDDSSSNSNTNVSSDEKSPKADRKRP-KTTSLDELKRRSKKT 211

Query: 311 LMRQRSTETRMTRQK 355
              +R T +  TR +
Sbjct: 212 RSPERRTMSAKTRSQ 226


>SB_48890| Best HMM Match : DUF560 (HMM E-Value=5.2)
          Length = 122

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 26/93 (27%), Positives = 37/93 (39%)
 Frame = +3

Query: 231 RSPPTRRTDHHYQRQRSSLQGRDRAYG**GREVQKRG*QGKRRPSRAKNALESYWLQHEV 410
           +S   RRTD + Q+ R    G+D      GR     G   K+ P +        WL H+ 
Sbjct: 18  KSGNARRTDRNSQKDRGIDDGKDEEDR--GRPPSSGGCTKKKSPDKR------SWLYHKS 69

Query: 411 LPWRMRSSRKRFS*TLTSRPFLEQVQHPPIQVD 509
           L   +R  + R + T   RP +     P   VD
Sbjct: 70  LCDTLRILKTRSNLTWNKRPGMYMFDEPNDAVD 102


>SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017)
          Length = 1495

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = +1

Query: 187  LRHRCQRYPQRFRY-REVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDH 363
            L+ R +R  +++ + RE  +         D GR ++EE ER   +  +  +E D++ G+ 
Sbjct: 941  LKPREEREKEQYEHTRETARSDYPTDRYPDDGRYTREEWERQEEDWRQRWDEWDRSTGER 1000

Query: 364  PGPRMHWNLTG 396
              P  +W+  G
Sbjct: 1001 GPPPPYWDEHG 1011


>SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26)
          Length = 185

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 13/40 (32%), Positives = 22/40 (55%)
 Frame = +2

Query: 158 PRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTK 277
           P GV +  ++  I  +G+L+V A++KS      +  P TK
Sbjct: 56  PEGVDESSISTRIAEDGMLHVEALKKSPPATTENKAPATK 95


>SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1384

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 22/71 (30%), Positives = 31/71 (43%)
 Frame = -2

Query: 214 EDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGGEC 35
           ED VGID EG+L++R   R      Q + T        +  TLK L   +  ++   G+ 
Sbjct: 402 EDDVGIDDEGNLHIRSVGRFNEGTYQCKATRLAGASSTAAFTLKILALNTPTILSAKGKA 461

Query: 34  LSLFSGDGSVT 2
            S    D  VT
Sbjct: 462 -SFGPRDADVT 471


>SB_37567| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 278

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = -3

Query: 159 GAGGIPVSSNLPSKLLSLVIARSPSNTWM 73
           G GG PV+S   SKL++ VIA   SN+++
Sbjct: 21  GRGGSPVTSRPGSKLINHVIASFQSNSFI 49


>SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0)
          Length = 1066

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = +3

Query: 9   LPSPLNRLRHSPPTLITNP 65
           LP   N + H+PPT + NP
Sbjct: 760 LPDTANEIEHAPPTTVINP 778


>SB_35714| Best HMM Match : Vicilin_N (HMM E-Value=5)
          Length = 288

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 7/77 (9%)
 Frame = +1

Query: 157 AAWRASN*GHLRHRCQ-----RYPQRFRYREVHQQGEQITITNDKGRLSKE-EIERMVNE 318
           A +RA   GH+  R Q     R P +   REV +QGE   +  D   L+ E E E +  +
Sbjct: 156 ACFRAGLRGHVHPRPQEGTDVRLPLQLHQREVRRQGEARLLFTDTDSLTYEIETEDVYQD 215

Query: 319 AEKYRNEDDKA-KGDHP 366
              + NE D+    D+P
Sbjct: 216 ---FWNEKDRLDNSDYP 229


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,781,867
Number of Sequences: 59808
Number of extensions: 464101
Number of successful extensions: 1518
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 1401
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1507
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1499981500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).