SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30012
         (706 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.6  
SB_52793| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.1  
SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33)                  30   2.1  
SB_27033| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.7  
SB_5767| Best HMM Match : Gal_Lectin (HMM E-Value=7.4e-08)             29   4.9  
SB_10132| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.4  
SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.5  

>SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 771

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 6/71 (8%)
 Frame = +1

Query: 1   LSHRNISKVGVVLIGY*INYHRV--SSKRISL----VSSKHKMRAFVVLACVAMAYGRPE 162
           +SH  +  + + +IGY  +YHRV   S  I L    +SS H++  F+ L       G P 
Sbjct: 637 VSHFLLLGIPLRIIGYPTSYHRVVFLSSGIPLPIIGLSSYHRVSHFLSLGIPLPIIGIPL 696

Query: 163 PPVGYSYSAPR 195
           P +GY  S  R
Sbjct: 697 PIIGYPTSYHR 707


>SB_52793| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 532

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = +1

Query: 376 ASEVMLDSVADMRVDTLVLLLYRNTSMFTYLPQNQLSKDFLVSL 507
           A +V  +   D++V  L  LL  NTSMF+   QN +SK  ++ L
Sbjct: 266 ARKVFTNKTQDIKVSKLTRLLVANTSMFS---QNLVSKSAVIKL 306


>SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33)
          Length = 662

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%)
 Frame = +3

Query: 432 PLVQKHI--YVHVPPPEPVEQRLPRI-PGVAPP 521
           P  Q HI   V  PPP P  QR PR  PG A P
Sbjct: 302 PAQQTHIGQMVQTPPPRPQPQRPPRAGPGTAGP 334


>SB_27033| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 960

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 19/76 (25%), Positives = 41/76 (53%), Gaps = 3/76 (3%)
 Frame = -3

Query: 458 NIDVFLYKRSTRVSTRISATESSITSEAQTAAAAKGESTTETESI---RRVSAAKGNAAS 288
           N D+F  +++ + + R S T+S+I   +    +A    TT++++I   +   A++G    
Sbjct: 493 NKDIFRKQKTVQNTFRTSKTKSNIAELSMAVKSAARAKTTQSQNITKNKEEKASEGKGER 552

Query: 287 RKAT*GSRMTTIATVL 240
           +K T  SR +++ + L
Sbjct: 553 KKNT--SRPSSVTSSL 566


>SB_5767| Best HMM Match : Gal_Lectin (HMM E-Value=7.4e-08)
          Length = 504

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 21/52 (40%), Positives = 23/52 (44%), Gaps = 4/52 (7%)
 Frame = +3

Query: 468 PPEPVEQRL-PRIPGV--APPQKHYKIIFIK-GPNSSHSYCPHNSYPTTKRR 611
           PP P   RL     GV   P  K  KI++   G  S  S CPH S  TT  R
Sbjct: 256 PPTPALFRLCEHRSGVLNCPQNKRIKILYSNYGRTSGRSVCPHPSIRTTSCR 307


>SB_10132| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 101

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 4/45 (8%)
 Frame = +2

Query: 182 TPLPEVTQEA-SALPLSAADTELLLWWS---FWIPRWPFWRQHFP 304
           TPLP  T  + +  P    DT +  W +   +W P  P+W  + P
Sbjct: 29  TPLPYWTPHSLTRHPYPLLDTHIPYWTAHIPYWTPYLPYWTPYLP 73


>SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 6489

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 17/63 (26%), Positives = 32/63 (50%)
 Frame = -3

Query: 431  STRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT*GSRMTTI 252
            +T ++  ++A+ +S+ +   T AAA   +   T +   +  A   AA+  A+  S +T  
Sbjct: 1121 ATTIAAAVTASTASVVTTTATVAAATTTAEKATTTTAAMVKATTTAAAVTASTASVVTKT 1180

Query: 251  ATV 243
            ATV
Sbjct: 1181 ATV 1183


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,289,367
Number of Sequences: 59808
Number of extensions: 287255
Number of successful extensions: 1069
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 939
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1067
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1853669818
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).