SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30011
         (766 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38)                 87   1e-17
SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   2e-14
SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16)                   56   2e-08
SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   1e-06
SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   6e-06
SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36)                  48   1e-05
SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24)                 45   6e-05
SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013)                   45   8e-05
SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18)                 44   1e-04
SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33)                 44   2e-04
SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0)                       41   0.001
SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0)                       41   0.001
SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.)               41   0.001
SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25)                 40   0.002
SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11)                  39   0.004
SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0)                       39   0.004
SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.007
SB_13046| Best HMM Match : La (HMM E-Value=5e-23)                      38   0.007
SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.009
SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0)               38   0.012
SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07)                  38   0.012
SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69)                    37   0.015
SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.020
SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15)                     37   0.020
SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23)                    37   0.020
SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23)                 36   0.027
SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.027
SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18)                 36   0.027
SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0)                        36   0.027
SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0)                       36   0.036
SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.047
SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.047
SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.062
SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20)                  35   0.083
SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.19 
SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24)                 33   0.25 
SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28)                 33   0.25 
SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0)                33   0.25 
SB_58997| Best HMM Match : PC_rep (HMM E-Value=4e-16)                  32   0.58 
SB_39416| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.58 
SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15)                 32   0.58 
SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0)                        32   0.58 
SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.77 
SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42)             31   1.0  
SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.3  
SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.3  
SB_38542| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23)                30   2.3  
SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.3  
SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35)                 29   4.1  
SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.1  
SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.1  
SB_44858| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.4  
SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13)                 28   7.2  
SB_42562| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.2  
SB_44083| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.5  
SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18)                   28   9.5  

>SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38)
          Length = 496

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 40/86 (46%), Positives = 56/86 (65%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVD V+MK  +  RS+GFGF+TY  +  V+E    + H +D R +EPKR+VPR+E  
Sbjct: 73  WGTIVDCVIMK--RDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESG 130

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
            PEA +  +K+FV GL     EED++
Sbjct: 131 APEAMSKTRKIFVGGLASTTVEEDIK 156



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 19/48 (39%), Positives = 31/48 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           L++YFS +G IV   ++  K  G+ RGFGFV ++  D V+ V  +++H
Sbjct: 66  LKDYFSQWGTIVDCVIM--KRDGRSRGFGFVTYESSDSVNEVLKKKDH 111



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 7/58 (12%)
 Frame = +2

Query: 506 LREYFSTF------GNIVSVSVVTDKETGKK-RGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++EYF++       G ++ V +  D++  K+ RGF FV FD+ + V++VC  + H+I+
Sbjct: 155 IKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIR 212



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKD-PKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           GE++DV + +D    KR +GF F+T+    +V++    + H+I  +  E K+A P+  ++
Sbjct: 169 GEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQSAMR 228

Query: 435 RPE 443
           + +
Sbjct: 229 KKD 231



 Score = 35.1 bits (77), Expect = 0.062
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = +1

Query: 172 EPEHTRKLFIGGLDYRTTDSSLKEFY 249
           E E  RK+FIGGL++ TT+  LK+++
Sbjct: 45  ESEKLRKIFIGGLNWNTTEEGLKDYF 70



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           P +     E    TRK+F+GGL   T +  +KE++
Sbjct: 125 PRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYF 159


>SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 299

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 37/91 (40%), Positives = 60/91 (65%), Gaps = 4/91 (4%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQ----AHMVDEAQNNRPHKIDGRIVEPKRAVP 419
           A+GE+ DVVV+ D  TK+S+GFG++T++      +++ +   N  H+IDG+ VE KRA+P
Sbjct: 36  AYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIP 95

Query: 420 REEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           R++        T KK+FV GL +D  +ED++
Sbjct: 96  RDDNSATSHEKT-KKIFVGGLPEDATKEDIQ 125



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDY 613
           LREYF  +G +  V V+ D  T K RGFG+V F DY
Sbjct: 30  LREYFEAYGELTDVVVICDSATKKSRGFGYVTFADY 65



 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/53 (32%), Positives = 31/53 (58%)
 Frame = +3

Query: 267 VDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           VD+++ K+ +TK  +GF F+  +     DE    +   + G++VE K+A PR+
Sbjct: 139 VDLIMKKEDETKH-RGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPRD 190



 Score = 31.9 bits (69), Expect = 0.58
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE-HGE 261
           KLF+GGL+  TT+ +L+E++E +GE
Sbjct: 15  KLFVGGLNRETTNETLREYFEAYGE 39



 Score = 29.1 bits (62), Expect = 4.1
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = +2

Query: 551 VVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++  ++  K RGF FVE ++ D  D +C  +   +K
Sbjct: 142 IMKKEDETKHRGFAFVELNNEDQADELCCVKKIHVK 177


>SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16)
          Length = 842

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 32/86 (37%), Positives = 48/86 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ + VVM+DP TKRS+GFGF+T+     VD   N+   ++DG     K+ V      
Sbjct: 131 FGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDG-----KKMV------ 179

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
                 T KK+F+ GL  +  EED++
Sbjct: 180 -----TTTKKIFIGGLSTNTSEEDMK 200



 Score = 38.3 bits (85), Expect = 0.007
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LR++F  FG +    V+ D  T + RGFGF+ F D   VD V
Sbjct: 124 LRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVV 165



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 10/28 (35%), Positives = 19/28 (67%)
 Frame = +1

Query: 184 TRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           T+K+FIGGL   T++  +K+++    K+
Sbjct: 182 TKKIFIGGLSTNTSEEDMKKYFSQFGKV 209


>SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 435

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN--NRPHKIDGRIVEPKRAVPREE 428
           +GEI    V  DP T+RS+GFGF+ + +    ++A+N  +  H+I GR+ E +   P+EE
Sbjct: 138 FGEIDFCEVKLDPNTRRSRGFGFVRFKKD---EDAKNVLSTSHRIQGRLCEVRLPRPKEE 194

Query: 429 IKRPEASATVKKLFVAGLKQDIEEEDL 509
           +  P      KKLFV  L +   E+ L
Sbjct: 195 LNVP------KKLFVGRLPESTTEKTL 215



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++EYF+ FG I    V  D  T + RGFGFV F   +    V L  +H+I+
Sbjct: 131 MKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNV-LSTSHRIQ 180


>SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 314

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 31/87 (35%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQ-AHMVDEAQNN-RPHKIDGRIVEPKRAVPREEIK 434
           ++  V + K P+ K S+ F F+ +S  + ++D    N   H ID + VE KRA+PR++  
Sbjct: 38  DVSSVSLAKTPEGK-SRKFCFVEFSNGSDIIDNIVFNFESHSIDNKQVEVKRAMPRDD-P 95

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
              A    KKLF+ GLK +  EED+++
Sbjct: 96  NELAHVRTKKLFIGGLKDEHSEEDVKT 122



 Score = 35.1 bits (77), Expect = 0.062
 Identities = 14/49 (28%), Positives = 31/49 (63%)
 Frame = +3

Query: 267 VDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +++ +++D +T + KG+ F+ +   H+VD+    R  ++ G+ VE K+A
Sbjct: 133 LEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 181



 Score = 33.5 bits (73), Expect = 0.19
 Identities = 16/48 (33%), Positives = 30/48 (62%)
 Frame = +2

Query: 539 VSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K 682
           + + +V D+ET K +G+ FV F +   VD++ L ++ Q+K  ++ M K
Sbjct: 133 LEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKK 180


>SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 10/83 (12%)
 Frame = +3

Query: 294 KTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPE---------- 443
           + +  KGFGF+T+     ++     +PH +DG+ ++PK AVPR   ++ +          
Sbjct: 137 RARMLKGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPRGPGQQAQTGAVMGGPQR 196

Query: 444 ASATVKKLFVAGLKQDIEEEDLE 512
            SA   K+F+ GL     EEDL+
Sbjct: 197 GSANDGKVFIGGLAFGTTEEDLK 219



 Score = 29.5 bits (63), Expect = 3.1
 Identities = 11/20 (55%), Positives = 16/20 (80%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFY 249
           K+FIGGL + TT+  LKE++
Sbjct: 203 KVFIGGLAFGTTEEDLKEYF 222


>SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36)
          Length = 328

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +2

Query: 503 RLREYFS-TFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++REYF   +  +  +  +T+  + ++RGF FV FD  D VD++C  Q H I+
Sbjct: 118 KIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIE 170



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 18/45 (40%), Positives = 26/45 (57%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +  L+EYFS +G +V V +  D  TG+ RGF FV+F      D +
Sbjct: 42  KESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAI 86



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/58 (29%), Positives = 33/58 (56%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           A+  + ++  + +  + R +GF F+++     VD+    + H I+G  VE KRA+P+E
Sbjct: 126 AYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPKE 183



 Score = 37.5 bits (83), Expect = 0.012
 Identities = 27/92 (29%), Positives = 43/92 (46%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE+V V +  D  T R +GF F+ +              H+ +   ++PK A
Sbjct: 45  LKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFK-------------HQSEADAIDPKPA 91

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
            P   I +P     VKK+FV GLK +  +E +
Sbjct: 92  AP---IGKP-PHLRVKKIFVGGLKPETSDEKI 119



 Score = 35.1 bits (77), Expect = 0.062
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFY-EHGE 261
           KLF+GGL Y TT  SLKE++ ++GE
Sbjct: 30  KLFVGGLSYETTKESLKEYFSKYGE 54



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 2/28 (7%)
 Frame = +1

Query: 172 EPEHTR--KLFIGGLDYRTTDSSLKEFY 249
           +P H R  K+F+GGL   T+D  ++E++
Sbjct: 96  KPPHLRVKKIFVGGLKPETSDEKIREYF 123


>SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24)
          Length = 407

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 21/51 (41%), Positives = 31/51 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           LRE F+T GN+ SV ++ D++TG  +GFG+V F+  D V       N + K
Sbjct: 72  LRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFK 122


>SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013)
          Length = 665

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 19/50 (38%), Positives = 33/50 (66%)
 Frame = +3

Query: 276 VVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           ++M D  T+R +GFGF+T+   +  D+A + + H I+ + VE K+A P+E
Sbjct: 1   MLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKE 50



 Score = 35.1 bits (77), Expect = 0.062
 Identities = 15/32 (46%), Positives = 19/32 (59%)
 Frame = +2

Query: 560 DKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           DK T + RGFGFV F+  +  D+ C  Q H I
Sbjct: 5   DKATQRHRGFGFVTFESENSADKACDTQYHLI 36


>SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18)
          Length = 291

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 20/53 (37%), Positives = 34/53 (64%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +++    +GEI + VV+KD  TK+SKG+GF+T + +   + A  N+   I+GR
Sbjct: 26  LRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAELACKNKRPMIEGR 78



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           LR++F+ FG I    V+ D+ T K +G+GFV     D  +  C  +   I+
Sbjct: 26  LRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAELACKNKRPMIE 76



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 11/25 (44%), Positives = 19/25 (76%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFY-EHGE 261
           KLF+GG+ Y + D +L++F+ + GE
Sbjct: 11  KLFVGGIPYESGDDALRKFFAQFGE 35


>SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33)
          Length = 392

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L+E FS  G ++S  +V D+ETGK +G+GF E+ D +
Sbjct: 40  QLKEIFSEVGPVISFRLVFDRETGKPKGYGFCEYKDQE 77


>SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 364

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 17/31 (54%), Positives = 24/31 (77%)
 Frame = +2

Query: 536 IVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           ++SV V+TD+ETG+ RGFGFV F   D +D+
Sbjct: 35  LLSVKVITDRETGRPRGFGFVTFGSEDEMDK 65



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           ++VDV V+ D +T+R +GF F+T+ S+ +M D        + DGR ++  +A  RE+
Sbjct: 254 DVVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQARSREQ 310



 Score = 37.5 bits (83), Expect = 0.012
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPREE 428
           ++ V V+ D +T R +GFGF+T+     +D+A +      +DGR ++  +A PR E
Sbjct: 35  LLSVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQPRGE 90



 Score = 34.3 bits (75), Expect = 0.11
 Identities = 15/33 (45%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L++ FS + ++V V V++D+ET + RGF FV F
Sbjct: 246 LQDRFSRY-DVVDVQVISDRETQRPRGFAFVTF 277


>SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 718

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKR 410
           +K I    G+IV + VM DP+ K SKGFGF+++      +EA N    K I GR +   R
Sbjct: 125 MKEICAEAGKIVSLKVMTDPEGK-SKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGR 183

Query: 411 AVPREEIKRPEASATVKK 464
           A  R E +  E  A ++K
Sbjct: 184 AKKRAE-RAAEVKAEIEK 200



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RLRE FS +G I S  V+ D + G  +GFGFV F   +   +   + N +I
Sbjct: 227 RLREEFSPYGTISSAKVMKD-DKGNSKGFGFVCFSSPEEATKAVTEMNGRI 276



 Score = 37.1 bits (82), Expect = 0.015
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +++E  +  G IVS+ V+TD E GK +GFGFV F+
Sbjct: 124 QMKEICAEAGKIVSLKVMTDPE-GKSKGFGFVSFE 157



 Score = 29.1 bits (62), Expect = 4.1
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPK 407
           +G I    VMKD K   SKGFGF+ +S      +A      +++GRI+  K
Sbjct: 235 YGTISSAKVMKDDKGN-SKGFGFVCFSSPEEATKAVT----EMNGRILISK 280


>SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 514

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++  F  FG + SV ++ D ET + +G+GFV+F + +   R   Q N
Sbjct: 258 VKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMN 304



 Score = 36.3 bits (80), Expect = 0.027
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           R L E+FS  G +  V +++D+ + + +G  ++EF D   V
Sbjct: 160 RDLEEFFSKVGQVSDVRIISDRNSRRSKGIAYIEFTDKSAV 200



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +K +   +G +  V ++ D +T RSKG+GF+ + +A     A
Sbjct: 258 VKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRA 299


>SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 389

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           +++ F T GN+ S  ++ D+ TG+  G+ FV +D+ D  ++   + N
Sbjct: 43  IKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMN 89



 Score = 29.5 bits (63), Expect = 3.1
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           F  FG I++  V+ D  +G+ RG GFV FD
Sbjct: 133 FKPFGKIITSKVLKDV-SGEGRGTGFVRFD 161


>SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25)
          Length = 159

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 15/32 (46%), Positives = 24/32 (75%)
 Frame = +2

Query: 533 NIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           ++V V V+TD+ETG+ RGFGFV F   + +++
Sbjct: 29  DVVDVKVITDRETGRPRGFGFVTFGSKEEMEK 60



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPREE 428
           ++VDV V+ D +T R +GFGF+T+     +++A +       DGR ++  +A PR E
Sbjct: 29  DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDFDGRPMKVNQAQPRGE 85


>SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11)
          Length = 248

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 15/25 (60%), Positives = 20/25 (80%)
 Frame = +2

Query: 533 NIVSVSVVTDKETGKKRGFGFVEFD 607
           N+V V V+TD+ETG+ RGFGFV  +
Sbjct: 106 NVVDVRVITDRETGRPRGFGFVTLE 130



 Score = 29.9 bits (64), Expect = 2.3
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKRSKGFGFIT 329
           +VDV V+ D +T R +GFGF+T
Sbjct: 107 VVDVRVITDRETGRPRGFGFVT 128


>SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 420

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 16/52 (30%), Positives = 29/52 (55%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           YF  +G +  V ++TD+ETGK +G G V+      V+++  +  H I +  +
Sbjct: 338 YFRPYGQVAKVHILTDRETGKSKGCGVVKLRHPGTVNKILEEPVHVIGKSQV 389



 Score = 33.5 bits (73), Expect = 0.19
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L++YF  FG + SV ++     G  R +GFV F D  P   V L+++H I
Sbjct: 96  LKDYFEQFGEVESVRIMR-TFLGYSRNYGFVLFKDDGPSKEV-LKKSHVI 143


>SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 347

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           RL + F  FG ++S  V  DK+T   + FGFV +D+
Sbjct: 277 RLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDN 312



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFG 592
           L + F  FG ++S  V  DK+T   + FG
Sbjct: 245 LMQTFQPFGTVISAKVFIDKQTNMSKCFG 273


>SB_13046| Best HMM Match : La (HMM E-Value=5e-23)
          Length = 442

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 17/51 (33%), Positives = 28/51 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           L++ FS FG ++ VS+   K  G+ +GF F+EF+     + V    N + K
Sbjct: 104 LKKVFSEFGKVLYVSLPRFKHNGEIKGFAFIEFESKQQAEHVVQMFNRESK 154


>SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 732

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 521 STFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           + F    +  V+ D+E+G+ RGFGFV++DD +   +V
Sbjct: 307 AAFEGCSNAKVIFDRESGESRGFGFVDYDDVETAKKV 343



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKRAVPREE 428
           V+ D ++  S+GFGF+ Y       +  +     ++DGR V    A PR E
Sbjct: 317 VIFDRESGESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLDFASPRTE 367


>SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0)
          Length = 298

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           L   F  FG+I  V +  D  T K RGFGFVEF+
Sbjct: 21  LHAAFIPFGDITDVQIPMDYTTSKHRGFGFVEFE 54



 Score = 31.5 bits (68), Expect = 0.77
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVP 419
           +G+I DV +  D  T + +GFGF+ +  A     A  N    ++ GR +    A P
Sbjct: 28  FGDITDVQIPMDYTTSKHRGFGFVEFEFAEDTAAAIDNMNESELFGRTIRVNLAKP 83


>SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07)
          Length = 252

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 13/29 (44%), Positives = 23/29 (79%)
 Frame = +2

Query: 542 SVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           +V+++TD+ETG+ RGFGFV F   + +++
Sbjct: 124 AVNIITDRETGRPRGFGFVTFGSKEEMEK 152



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +3

Query: 273 VVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPR 422
           V ++ D +T R +GFGF+T+     +++A +      +DGR ++   A PR
Sbjct: 125 VNIITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEAKPR 175


>SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69)
          Length = 166

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 16/45 (35%), Positives = 26/45 (57%)
 Frame = +3

Query: 282 MKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAV 416
           +KD K+ RSK +GF+ +      ++A  N+PH I+G+   P   V
Sbjct: 94  VKDLKSGRSKKYGFVFFKDEEACEKAMGNQPHFIEGQKSGPSSPV 138


>SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1208

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 14/28 (50%), Positives = 24/28 (85%)
 Frame = +2

Query: 527 FGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +G IV+V++V DK+TGK++GF F+ ++D
Sbjct: 2   YGEIVNVNLVRDKKTGKQKGFCFLCYED 29



 Score = 34.7 bits (76), Expect = 0.083
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 398
           +GEIV+V +++D KT + KGF F+ Y  Q   +    N    K+ GR +
Sbjct: 2   YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRSTILAVDNFNGIKLGGRTI 50


>SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15)
          Length = 145

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR--IVEPK 407
           +G I D+ +++  +T +SKGFG++TY  A     A     H IDG+  I EPK
Sbjct: 86  YGAIEDLSIIRT-QTGKSKGFGYVTYENAESAQRALAG-THIIDGKWVIAEPK 136



 Score = 31.9 bits (69), Expect = 0.58
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L   F  +G I  +S++   +TGK +GFG+V +++ +   R
Sbjct: 79  LESVFGPYGAIEDLSIIRT-QTGKSKGFGYVTYENAESAQR 118


>SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23)
          Length = 44

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 14/28 (50%), Positives = 24/28 (85%)
 Frame = +2

Query: 527 FGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +G IV+V++V DK+TGK++GF F+ ++D
Sbjct: 2   YGEIVNVNLVRDKKTGKQKGFCFLCYED 29



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 368
           +GEIV+V +++D KT + KGF F+ Y        A +N
Sbjct: 2   YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRSTILAVDN 39


>SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23)
          Length = 362

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L + F  FG ++S  V  DK+T   + FGFV +D+
Sbjct: 293 LMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDN 327


>SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 828

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           R+ F  +GNIV+  ++ DK TG  +G GFV +D
Sbjct: 150 RKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLYD 182


>SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18)
          Length = 209

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 14/44 (31%), Positives = 27/44 (61%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           FS FG I+S  V+ D++TG+   + F+EF+  +  +R   + ++
Sbjct: 140 FSRFGTILSCEVIRDQKTGESLQYAFIEFEKDEDCERAYFKMDN 183


>SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 593

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 13/47 (27%), Positives = 25/47 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           ++  F  FG +V  S+  +  TGK +G+GF+E+++    +      N
Sbjct: 215 IKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIASMN 261



 Score = 36.3 bits (80), Expect = 0.027
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           IK +  A+G++V   + K+P T + KG+GFI Y      ++A
Sbjct: 215 IKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDA 256



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +R  F  FG I  + +  D    K +GF FVE+D
Sbjct: 118 IRTAFHPFGPINKIDLSWDPLNMKHKGFAFVEYD 151


>SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 382

 Score = 35.9 bits (79), Expect = 0.036
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSV-SVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L + FS FG I+    ++ D +TG  +GF F+ F  +D  D      N Q
Sbjct: 116 LYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQ 165



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           E F   G +V+V +  D+ T   +G+GFVEF
Sbjct: 31  ELFLQSGPVVNVHMPKDRITQLHQGYGFVEF 61


>SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 781

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LR  F +FG+I  V +V D +T + +G+G+V+F
Sbjct: 69  LRSKFESFGDIEYVQIVRDHKTRENKGYGYVKF 101



 Score = 33.1 bits (72), Expect = 0.25
 Identities = 14/52 (26%), Positives = 29/52 (55%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPK 407
           ++G+I  V +++D KT+ +KG+G++ + ++     A  N    +     EPK
Sbjct: 75  SFGDIEYVQIVRDHKTRENKGYGYVKFHKSSTAAMALENCDKSLKAVWAEPK 126


>SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 628

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = +2

Query: 521 STFGNIVSVSVVTDKETGKKRGFGFVEF 604
           S  G + +V + TDK TG++R FGFVEF
Sbjct: 478 SNAGPLENVRIPTDKNTGQQRSFGFVEF 505


>SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 291

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           + + F  FG +  V ++ DKE+G+ RGFGFV     D +
Sbjct: 25  IEQAFEEFG-VEKVDILRDKESGRSRGFGFVLLQSADQI 62



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = +3

Query: 273 VVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREE 428
           V +++D ++ RS+GFGF+    A  +  A +      + GR +    A+ + E
Sbjct: 37  VDILRDKESGRSRGFGFVLLQSADQIAPAIEKMNQSSVGGRNITVALALDKTE 89


>SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20)
          Length = 1313

 Score = 34.7 bits (76), Expect = 0.083
 Identities = 13/41 (31%), Positives = 25/41 (60%)
 Frame = +2

Query: 506  LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
            ++E FS +G + +V + TD+     RGF +VE+ D +  ++
Sbjct: 1173 VQEIFSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEK 1213


>SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 610

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 20/49 (40%), Positives = 27/49 (55%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEP 404
           G I D  +M DP +  +KGF F T+S     DEAQ N   K+D + + P
Sbjct: 176 GHIYDFRLMIDPISGLTKGFAFCTFSNK---DEAQ-NAVKKLDNKEIRP 220


>SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24)
          Length = 343

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 19/58 (32%), Positives = 28/58 (48%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           EYFST G  V         +GK +GF FV     + V+ V  + +H I   ++ M K+
Sbjct: 60  EYFSTLGEQVEHVKCIRTLSGKSKGFAFVRLRKKEAVESVLGRDDHVIDNSDVSMEKQ 117



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDG 389
           GEI  V + ++ KTK  KG   +T++      E    R H I G
Sbjct: 145 GEIASVYIPENLKTKERKGHCIVTFASVTEAFEVVKKRKHHIHG 188


>SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28)
          Length = 419

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +2

Query: 527 FGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +G I+S   + DK+T   +G+GFV+F+
Sbjct: 123 YGTIISTKAILDKDTNLCKGYGFVDFE 149


>SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0)
          Length = 672

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L   F+ + + +   +V DK++ K +G+GFV F D
Sbjct: 233 LTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSFKD 267


>SB_58997| Best HMM Match : PC_rep (HMM E-Value=4e-16)
          Length = 181

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 14/29 (48%), Positives = 22/29 (75%)
 Frame = +3

Query: 576 RKGALVL*SLMIMIQLTEYACNKITKLKD 662
           R+GALV  S +I+IQ TE+ C+K+ K ++
Sbjct: 125 RQGALVA-SALILIQQTEHTCSKVAKFRE 152


>SB_39416| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 738

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 14/29 (48%), Positives = 22/29 (75%)
 Frame = +3

Query: 576 RKGALVL*SLMIMIQLTEYACNKITKLKD 662
           R+GALV  S +I+IQ TE+ C+K+ K ++
Sbjct: 397 RQGALVA-SALILIQQTEHTCSKVAKFRE 424


>SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15)
          Length = 171

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 13/53 (24%), Positives = 27/53 (50%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRF 664
           ++++F  FG +  + +   K++ + +G+ FVEF   D V ++     H    F
Sbjct: 114 IKKFFEQFGTVNRIRLSRSKKSARSKGYAFVEF-ACDEVAKIAADTMHNYMMF 165


>SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 1026

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 2/35 (5%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDK--ETGKKRGFGFVEF 604
           L+E FS FG +   SV   K     +K GFGFV+F
Sbjct: 263 LKETFSAFGEVSEASVPQKKVGRRNRKMGFGFVQF 297


>SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 31.5 bits (68), Expect = 0.77
 Identities = 10/44 (22%), Positives = 26/44 (59%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 365
           +K++   +G++ D+ + +D  T  S+GF F+ + +    ++A +
Sbjct: 32  LKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRFYEKRDAEDAMD 75


>SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42)
          Length = 1531

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +1

Query: 148 SESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE-HGE 261
           S   +D  +P  TR LF+G ++  TT   LKE +E +GE
Sbjct: 236 SNYSEDEFDPGCTRTLFVGNIEKTTTYGDLKEAFERYGE 274


>SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 871

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +  S +GNI  + +V  + TG  +G+GFVE+
Sbjct: 131 DLMSPYGNIERLFLVRSEVTGDSKGYGFVEY 161



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN-HQIKRFNI 670
           ++E FS  GN+    V  +   G  RGF FV++   +  ++     N  Q++  NI
Sbjct: 222 IKELFSQTGNVTFAQVAINPANGGSRGFAFVDYATAEEAEKGQRAHNGRQVEGSNI 277


>SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 333

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 13/34 (38%), Positives = 23/34 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + E FS  G +  V +VT++  GK +G+G+VE++
Sbjct: 187 IEELFSKHGVVKQVRLVTNR-AGKPKGYGYVEYE 219


>SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 949

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 5/69 (7%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKRSKGFGFI---TYSQAHMVDE--AQNNRPHKIDGRIVEPKRAVPREE 428
           I D+ ++KD  T  S+GF F+   T  +A  + E  A  N P  IDGR++    A   E 
Sbjct: 436 IYDIRLIKDKVTGTSRGFCFVELATIEEATQLLELIAAMNPPFMIDGRVITTLYARKSEP 495

Query: 429 IKRPEASAT 455
              P   +T
Sbjct: 496 SPVPTTKST 504


>SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 254

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 563 KETGKKRGFGFVEFDDYDPVD 625
           +E   K G+GFVEFDDY   D
Sbjct: 32  REISMKLGYGFVEFDDYRDAD 52


>SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1309

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 11/21 (52%), Positives = 17/21 (80%)
 Frame = +3

Query: 270 DVVVMKDPKTKRSKGFGFITY 332
           +V V+KDP   +SKGFGF+++
Sbjct: 541 EVRVVKDPAKNKSKGFGFVSF 561


>SB_38542| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 606

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = +2

Query: 167 MKNLNTHVNFLSVDSTIEPQILH*KNSMSMGRNCRCSCNERPKNQEIKR 313
           +K LNTH  +   +  + P+ L  K+  S  ++ R    E P NQ++ R
Sbjct: 62  LKRLNTHARYKREEPWLAPKNLSIKSVESRHQSVRTCLTELPTNQKMSR 110


>SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23)
          Length = 2386

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L E F+ FG +  V ++ D E+GK R  GFV F   D  +   +  N
Sbjct: 540 LLELFNKFGPVKDVVILRD-ESGKSRQSGFVHFWSSDVAEAANVGMN 585


>SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1291

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 4/87 (4%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN--NRPHKIDGRIVEPK 407
           +K +L ++GE+    ++KD  T  SKG+ F  Y    + D A    N     D +++  +
Sbjct: 689 VKELLSSFGELRAFNLVKDSATGLSKGYAFCEYVDLGITDVAIQGLNGMQLGDKKLIVQR 748

Query: 408 RAV-PREEIKRPEASATV-KKLFVAGL 482
            +V  ++ +  P+A   V  +L + GL
Sbjct: 749 ASVGAKQNLNNPQAMNMVPAQLQIPGL 775


>SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1182

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +2

Query: 506  LREYFSTFGNIVSVSVVTDKETGKKRG 586
            L  +FS FG +  V +V D+ TG  +G
Sbjct: 1082 LETFFSNFGPVADVRIVCDRRTGLNKG 1108


>SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35)
          Length = 929

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 1/24 (4%)
 Frame = +2

Query: 563 KETGKKRGFGFVEFDDY-DPVDRV 631
           ++   KRG+GFVEFDD+ D  D V
Sbjct: 716 RDISLKRGYGFVEFDDHRDAEDAV 739


>SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 414

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = +2

Query: 545 VSVVTDKETGKKRGFGFVEF-DDYDPVD 625
           V VV D+ET + R FG+V F D+ D  D
Sbjct: 5   VIVVYDRETRRSRNFGYVTFRDEQDAAD 32



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 9/21 (42%), Positives = 18/21 (85%)
 Frame = +3

Query: 270 DVVVMKDPKTKRSKGFGFITY 332
           +V+V+ D +T+RS+ FG++T+
Sbjct: 4   EVIVVYDRETRRSRNFGYVTF 24


>SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 371

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 16/61 (26%), Positives = 33/61 (54%), Gaps = 8/61 (13%)
 Frame = +3

Query: 264 IVDVVVMKDPKTK-------RSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVP 419
           + DV+++K+P+ +       RS+GFGF+T++       A  +   K + GR ++   ++ 
Sbjct: 77  VTDVLIVKEPRNEFYQQQEPRSRGFGFVTFANPEDAQTAVKSLNGKEVQGRTLKIAPSIS 136

Query: 420 R 422
           R
Sbjct: 137 R 137


>SB_44858| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 442

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = +3

Query: 399 EPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           EPKR   +  + R E   T KK   A  KQD EEE+L+
Sbjct: 401 EPKRKTGKPLMFRSEPPQTRKKQQDADKKQDKEEEELK 438


>SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13)
          Length = 260

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +3

Query: 288 DPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIVEPKRAVPREEIK 434
           +P   R +GFGF+T++ A   ++A+      I DGR VE    + +  I+
Sbjct: 117 NPLNLRIEGFGFVTFNTAAEANKAREKLNGTIVDGRKVEVSLCMEQSYIR 166


>SB_42562| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 186

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGF 595
           ++  EY S  G+    S++ DKETG     GF
Sbjct: 41  KKADEYLSVHGDKADASIIHDKETGITTKIGF 72


>SB_44083| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +3

Query: 384 DGRIVEPKRAVPREEIKRPEASATV 458
           D R VEP  ++P  E+KR  A  +V
Sbjct: 99  DNRAVEPPESIPNSEVKRSIADGSV 123


>SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18)
          Length = 268

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G + +  +++D K   SKG+ FIT+    + D  ++N+      +++   +AV R+
Sbjct: 31  YGVVKESKIVRD-KHGVSKGYAFITFESQEVADGLRDNKGLDFKDKVLSIGQAVRRK 86


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,875,911
Number of Sequences: 59808
Number of extensions: 392565
Number of successful extensions: 1124
Number of sequences better than 10.0: 63
Number of HSP's better than 10.0 without gapping: 976
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1115
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2072022557
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).