SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30009
         (801 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_35188| Best HMM Match : RVT_1 (HMM E-Value=2.3e-25)                 31   1.1  
SB_7362| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.1  
SB_5148| Best HMM Match : RVT_1 (HMM E-Value=1.7e-27)                  31   1.1  
SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.1  
SB_26687| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.4  
SB_48450| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.7  

>SB_35188| Best HMM Match : RVT_1 (HMM E-Value=2.3e-25)
          Length = 467

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%)
 Frame = +2

Query: 488 KLEC*LHILN-WITKIRLRLNHFDSDIALYSS 580
           K+EC +H +N W+    L+LNH  S++ L+SS
Sbjct: 208 KVECCVHEINAWMVHNGLKLNHDKSELILFSS 239


>SB_7362| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 578

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%)
 Frame = +2

Query: 488 KLEC*LHILN-WITKIRLRLNHFDSDIALYSS 580
           K+EC +H +N W+    L+LNH  S++ L+SS
Sbjct: 424 KVECCVHEINAWMVHNGLKLNHDKSELILFSS 455


>SB_5148| Best HMM Match : RVT_1 (HMM E-Value=1.7e-27)
          Length = 286

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%)
 Frame = +2

Query: 488 KLEC*LHILN-WITKIRLRLNHFDSDIALYSS 580
           K+EC +H +N W+    L+LNH  S++ L+SS
Sbjct: 212 KVECCVHEINAWMVHNGLKLNHDKSELILFSS 243


>SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1332

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%)
 Frame = +2

Query: 488 KLEC*LHILN-WITKIRLRLNHFDSDIALYSS 580
           K+EC +H +N W+    L+LNH  S++ L+SS
Sbjct: 821 KVECCVHEINAWMVHNGLKLNHDKSELILFSS 852


>SB_26687| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 614

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%)
 Frame = +2

Query: 488 KLEC*LHILN-WITKIRLRLNHFDSDIALYSS 580
           K+EC +H +N W+    L+LNH  S++ L+SS
Sbjct: 407 KVECCVHEINAWMVYNGLKLNHDKSELILFSS 438


>SB_48450| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 457

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +1

Query: 667 NCLRFIYWHYVTIFTLFLKGM*YFRCQIGVATYYWGR 777
           N LR    + VT F LFL G       +GVA+YYW R
Sbjct: 336 NILRVAAVNSVTSFLLFL-GKVLVTSIVGVASYYWFR 371


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,684,536
Number of Sequences: 59808
Number of extensions: 415864
Number of successful extensions: 720
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 625
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 720
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2215746665
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).