SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30008
         (465 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   2e-11
SB_54084| Best HMM Match : zf-CCCH (HMM E-Value=0.00066)               29   1.4  
SB_28701| Best HMM Match : DUF680 (HMM E-Value=6.7)                    29   1.4  
SB_23913| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.4  
SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0)               29   2.5  
SB_51054| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.8  
SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.8  
SB_15062| Best HMM Match : Tctex-1 (HMM E-Value=9.8e-19)               27   5.8  
SB_35522| Best HMM Match : AT_hook (HMM E-Value=7.3)                   27   7.7  
SB_14108| Best HMM Match : zf-C2H2 (HMM E-Value=0.13)                  27   7.7  
SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.7  

>SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1084

 Score = 65.7 bits (153), Expect = 2e-11
 Identities = 31/38 (81%), Positives = 32/38 (84%)
 Frame = +1

Query: 73   GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
            G    GTGILLAVTIIYQYFEIFVKEQ+EMGGM  LLF
Sbjct: 1047 GAIGSGTGILLAVTIIYQYFEIFVKEQSEMGGMGALLF 1084



 Score = 62.9 bits (146), Expect = 1e-10
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +3

Query: 3    YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
            YIPTAAAFGGLCIGALSVLADFLGAIGSG
Sbjct: 1024 YIPTAAAFGGLCIGALSVLADFLGAIGSG 1052


>SB_54084| Best HMM Match : zf-CCCH (HMM E-Value=0.00066)
          Length = 731

 Score = 29.5 bits (63), Expect = 1.4
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = +1

Query: 235 FYCRFCSNRHH*VYVFISGSVGCEYIVVLYRKN 333
           F C+ C NRH+  Y F+    G  Y V  Y +N
Sbjct: 527 FLCKGCENRHNGYYAFLDYRKGLWYKVRPYPRN 559


>SB_28701| Best HMM Match : DUF680 (HMM E-Value=6.7)
          Length = 294

 Score = 29.5 bits (63), Expect = 1.4
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = -3

Query: 301 IQHYQI*KRTPNDVDS-SRNDNKNGAERSGPTAAIITRLR 185
           + H+++ ++  N VD  S N+N   AER+ PT A  TR R
Sbjct: 67  LAHWKMDEQLGNTVDDDSGNENHGTAERASPTRAKFTRGR 106


>SB_23913| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 905

 Score = 29.5 bits (63), Expect = 1.4
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 3/84 (3%)
 Frame = -1

Query: 273 HLMMSIRAETTIKTELNAAVRLPLSLRD---LEEQCAHAAHLRLFLDKDLEVLVNDGDGE 103
           HL+++     T++     AVR+PL+L D    E Q   +   ++ +  D    V DG   
Sbjct: 361 HLLVTFYNGQTVEIGAGVAVRIPLALFDRLVTELQLPESQRRKITIATDSTPPVYDG--- 417

Query: 102 QYPSARSRWPRGSRPALTEPRCTV 31
           + P A + W R   P  ++ R  V
Sbjct: 418 RAPPAETTWQRPFSPPKSQRRNNV 441


>SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0)
          Length = 1066

 Score = 28.7 bits (61), Expect = 2.5
 Identities = 24/89 (26%), Positives = 35/89 (39%)
 Frame = -3

Query: 280 KRTPNDVDSSRNDNKNGAERSGPTAAIITRLRRAVCSCRPSPLVP*QRSRSTGK*W*RRA 101
           K  PN+ D    +    A+ SG   ++I        +  P      + +  T      +A
Sbjct: 722 KHLPNNADRDVFEEMRAAKESGTLDSLIEAAENMRIADLPDTANEIEHAPPTTVINPPQA 781

Query: 100 VSQCPEPMAPRKSASTDRAPMHSPPNAAA 14
               PEP+APR S S    P  +PP  AA
Sbjct: 782 KPAEPEPLAPRPS-SPQTQPAPAPPEPAA 809


>SB_51054| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 4/38 (10%)
 Frame = -1

Query: 108 GEQYPSARSRWPRGSRP----ALTEPRCTVLRTRPPSG 7
           G     AR+R PRG R      LTEP  TV R R P G
Sbjct: 99  GPPMDRARARSPRGRRQFKISLLTEPDTTVDRARYPRG 136


>SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 801

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +3

Query: 30  GLCIGALSVLADFLGAIGSGHWDT 101
           G+ +  +  +  F+  I SGHWDT
Sbjct: 35  GITLNTVDSVESFVNEINSGHWDT 58


>SB_15062| Best HMM Match : Tctex-1 (HMM E-Value=9.8e-19)
          Length = 851

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%)
 Frame = -3

Query: 85  EPMAPRKSASTDR-APMHSPPNAAAV 11
           EP AP  +  T   AP+ SPP+AAAV
Sbjct: 265 EPPAPPPTTPTSAGAPLSSPPSAAAV 290


>SB_35522| Best HMM Match : AT_hook (HMM E-Value=7.3)
          Length = 250

 Score = 27.1 bits (57), Expect = 7.7
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = -1

Query: 285 YENVHLMMSIRAETTIKTELNAAVRLPLSLRDLEEQCAHAA 163
           Y N    ++I A  ++K+ L  A++ PL  R L+    H+A
Sbjct: 49  YNNQDNKLTITAHASMKSTLTPALKAPLHPRPLQHLYEHSA 89


>SB_14108| Best HMM Match : zf-C2H2 (HMM E-Value=0.13)
          Length = 404

 Score = 27.1 bits (57), Expect = 7.7
 Identities = 8/16 (50%), Positives = 12/16 (75%)
 Frame = +1

Query: 22 RSEDCASGLCQCWPTS 69
          +SE C+ GLC CW ++
Sbjct: 35 KSEKCSKGLCCCWSSA 50


>SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1109

 Score = 27.1 bits (57), Expect = 7.7
 Identities = 18/66 (27%), Positives = 32/66 (48%)
 Frame = -1

Query: 300 SNTTRYENVHLMMSIRAETTIKTELNAAVRLPLSLRDLEEQCAHAAHLRLFLDKDLEVLV 121
           S +T  E ++ M  +R+  ++ T      +  +SLRD EEQ       +    ++ E+L 
Sbjct: 65  SPSTPSEVIYQMSPVRSSPSLSTGSITPRKSKISLRDDEEQMPPPRKRKGTEGEEGEILS 124

Query: 120 NDGDGE 103
           +  DGE
Sbjct: 125 DGSDGE 130


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,767,730
Number of Sequences: 59808
Number of extensions: 292250
Number of successful extensions: 1130
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 960
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1130
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 957531822
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).