SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30007
         (796 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_32767| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.3  
SB_32383| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.3  
SB_11932| Best HMM Match : RNA_pol_Rpb2_6 (HMM E-Value=0)              29   5.7  
SB_10969| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.7  
SB_46036| Best HMM Match : PSRT (HMM E-Value=1)                        28   7.6  

>SB_32767| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1259

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 15/51 (29%), Positives = 21/51 (41%)
 Frame = +3

Query: 291 PHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYD 443
           PHA  + A     HYA P + AAP +++     K     +       P YD
Sbjct: 622 PHAQVFFAGRGVHHYAIPQYTAAPSSEIAKIVKKEPTECNETSSVWRPWYD 672


>SB_32383| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1850

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 11/17 (64%), Positives = 13/17 (76%)
 Frame = -2

Query: 684 KSNDEPRRTGAVGNMSC 634
           KS+DEP+R G  GNM C
Sbjct: 277 KSSDEPKRYGMCGNMPC 293


>SB_11932| Best HMM Match : RNA_pol_Rpb2_6 (HMM E-Value=0)
          Length = 498

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = +3

Query: 450 YSVADGHSGDNKSQHESRDGTLCTASTLWLKLTV-QCARLSTPL 578
           YS+A G+ GD K  H++R G     + L    T+    RL++P+
Sbjct: 38  YSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPI 81


>SB_10969| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 846

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = +3

Query: 450 YSVADGHSGDNKSQHESRDGTLCTASTLWLKLTV-QCARLSTPL 578
           YS+A G+ GD K  H++R G     + L    T+    RL++P+
Sbjct: 450 YSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPI 493


>SB_46036| Best HMM Match : PSRT (HMM E-Value=1)
          Length = 878

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 18/68 (26%), Positives = 31/68 (45%)
 Frame = +3

Query: 387 HKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARL 566
           H+   + HH ++  HP+ D     AD H  D +   +  D    T+ T+  K +V  A+ 
Sbjct: 671 HRRQDADHHRQDVVHPRQD-----ADHHRQDAEHHRQDADHIAKTSFTIG-KTSVTIAKT 724

Query: 567 STPLTTTT 590
           S  +  T+
Sbjct: 725 SVTIAKTS 732


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,280,346
Number of Sequences: 59808
Number of extensions: 241162
Number of successful extensions: 819
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 753
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 816
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2191792647
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).