SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30005
         (981 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     36   0.066
SB_18941| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.4  
SB_4412| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   3.3  
SB_43666| Best HMM Match : SAP (HMM E-Value=1.2e-08)                   29   7.6  
SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0)                 29   7.6  
SB_4748| Best HMM Match : RVT_1 (HMM E-Value=0.0022)                   29   7.6  

>SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 4303

 Score = 35.5 bits (78), Expect = 0.066
 Identities = 18/63 (28%), Positives = 34/63 (53%)
 Frame = +2

Query: 380  EELGEKLKDGRS*TFIQDSMQTGKWNWAQIHNFERFPGFPPHKSFWESP*REQLPKEKPL 559
            +++ EKLK   +    Q+ +Q+ K  W Q+ N ++ PG  P  S  E   +  L +++P+
Sbjct: 2204 KQIREKLKPAENVVQYQEPLQSQKLIWKQVMNGQQDPGLEPDLSLQEGILKPILQRQEPV 2263

Query: 560  QRL 568
             +L
Sbjct: 2264 LQL 2266


>SB_18941| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 431

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 16/48 (33%), Positives = 23/48 (47%)
 Frame = -1

Query: 342 TMAAIEIL*SCVPVAVREPVSLKVLAERLLHWARSFSRLWPSEFHEWL 199
           TM    +L    P+ + E VSL  +A+ L H  + F  L  S  H W+
Sbjct: 313 TMTTASVLFDDQPIFMFEDVSLNKVADALAHTRQQFKSLETSTNHAWI 360


>SB_4412| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1095

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 4/37 (10%)
 Frame = +3

Query: 231 GKTNGPSE----VAVRQELSRKLVHGQQQGRNFIEFL 329
           GKT  P E    +A++Q +SRK++     GRNFI  L
Sbjct: 229 GKTKWPEEEDEEIAIQQRISRKVIWLVSTGRNFIVVL 265


>SB_43666| Best HMM Match : SAP (HMM E-Value=1.2e-08)
          Length = 256

 Score = 28.7 bits (61), Expect = 7.6
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +2

Query: 467 IHNFERFPGFPPHKSFWESP*REQLPKEKPLQRLLNGKGTVAS*KEPFIQSYVFWK 634
           +H+++     P    + + P +  L K+K   R  +GKGTVAS  EP I ++VF K
Sbjct: 165 LHDYKEST-IPAVGPYIQKPFKIALEKQKEKLRGKSGKGTVAS--EPNILAWVFEK 217


>SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0)
          Length = 536

 Score = 28.7 bits (61), Expect = 7.6
 Identities = 12/43 (27%), Positives = 19/43 (44%)
 Frame = +2

Query: 371 PFWEELGEKLKDGRS*TFIQDSMQTGKWNWAQIHNFERFPGFP 499
           P W++LGEK KD       +      +    ++H+F     FP
Sbjct: 422 PIWDQLGEKYKDHADIVVAKMDSTANEVEGVKVHSFPTIKYFP 464


>SB_4748| Best HMM Match : RVT_1 (HMM E-Value=0.0022)
          Length = 1012

 Score = 28.7 bits (61), Expect = 7.6
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +1

Query: 493  LSPPQIFLGKPLKGTASQRKTPSEIIKWEGNRGFLEGTFH--SKLCFL 630
            +SP QI  G+PL+ T S     + + K+  N+G+++G+ H  S L FL
Sbjct: 895  VSPAQIIFGRPLRDTLS---FVNRLEKF-SNQGWIQGSLHALSSLLFL 938


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,101,884
Number of Sequences: 59808
Number of extensions: 583390
Number of successful extensions: 1492
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1405
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1490
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2907797044
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).