SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30004
         (843 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.2  
SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.0  
SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9)                     30   2.0  
SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31)              30   2.7  
SB_34624| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14)         29   3.6  
SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.2  
SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.2  
SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.2  
SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.2  
SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1)                    28   8.2  

>SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +2

Query: 17 ALELVDPPGLQEF 55
          ALELVDPPGLQEF
Sbjct: 57 ALELVDPPGLQEF 69


>SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = -2

Query: 92 VTVSVGGPCRSCRIPAAPGDPLVLER 15
          V   +G     C++P+ PGDPLVLER
Sbjct: 22 VAAKLGASGTQCKVPS-PGDPLVLER 46


>SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9)
          Length = 146

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 16/31 (51%), Positives = 18/31 (58%)
 Frame = -2

Query: 107 NYINTVTVSVGGPCRSCRIPAAPGDPLVLER 15
           N INT T  VG    +     +PGDPLVLER
Sbjct: 6   NAINTETKPVGAHNMAGSNSCSPGDPLVLER 36


>SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31)
          Length = 974

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = -2

Query: 110 FNYINTVTVSVGGPCRSCRIPAAPGDPLVLER 15
           F Y+N +  S+G    +  +P  PGDPLVLER
Sbjct: 835 FAYVNALIGSLGSSVLAYILP--PGDPLVLER 864


>SB_34624| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 392

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -3

Query: 358 SISRSRTLPRAYLRPCLECRPTWSETKQLYKT 263
           SI+R    P   +RP L+C P WS T  +  T
Sbjct: 228 SITRPAVAPITRVRPGLDCLPVWSTTLPITST 259


>SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14)
          Length = 593

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 14/21 (66%), Positives = 15/21 (71%)
 Frame = -2

Query: 77  GGPCRSCRIPAAPGDPLVLER 15
           GGP  SC    +PGDPLVLER
Sbjct: 134 GGPSNSC----SPGDPLVLER 150


>SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 180

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 3/22 (13%)
 Frame = -2

Query: 71  PCRSCRIPA---APGDPLVLER 15
           P   CR+P+   +PGDPLVLER
Sbjct: 49  PDAHCRVPSNSCSPGDPLVLER 70


>SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 16/29 (55%), Positives = 17/29 (58%)
 Frame = -2

Query: 101 INTVTVSVGGPCRSCRIPAAPGDPLVLER 15
           I T+ VS    CR   I   PGDPLVLER
Sbjct: 10  IITIKVSSSKDCRG-GIHNGPGDPLVLER 37


>SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 13/22 (59%), Positives = 14/22 (63%)
 Frame = -2

Query: 80 VGGPCRSCRIPAAPGDPLVLER 15
          V   CRS     +PGDPLVLER
Sbjct: 22 VASLCRSRSNSCSPGDPLVLER 43


>SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 4/33 (12%)
 Frame = -1

Query: 102 YKYGYC--KCGRAVP--LVPNSCSPGGSTSSRA 16
           + Y YC  KC + +P  ++     PGGSTSSRA
Sbjct: 21  WSYTYCCNKCEKHLPPSVIIEFLQPGGSTSSRA 53


>SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1)
          Length = 275

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 14/25 (56%), Positives = 17/25 (68%)
 Frame = -2

Query: 89  TVSVGGPCRSCRIPAAPGDPLVLER 15
           + +VGG   SC    +PGDPLVLER
Sbjct: 145 SAAVGGGSNSC----SPGDPLVLER 165


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,000,644
Number of Sequences: 59808
Number of extensions: 388334
Number of successful extensions: 3050
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 2867
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3032
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2383424791
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).