SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30001
         (833 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38)                149   3e-36
SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.)             144   6e-35
SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08)                144   6e-35
SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.)             138   7e-33
SB_29934| Best HMM Match : Vicilin_N (HMM E-Value=1.4)                129   3e-30
SB_31729| Best HMM Match : RVT_1 (HMM E-Value=0.023)                  128   4e-30
SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.)             126   2e-29
SB_28986| Best HMM Match : No HMM Matches (HMM E-Value=.)             125   4e-29
SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25)                123   2e-28
SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23)                  119   3e-27
SB_51049| Best HMM Match : No HMM Matches (HMM E-Value=.)             116   3e-26
SB_13911| Best HMM Match : PAN (HMM E-Value=0.033)                    109   2e-24
SB_57155| Best HMM Match : RTP (HMM E-Value=4.2)                       93   2e-19
SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33)                 91   1e-18
SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.)              91   1e-18
SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044)                 89   3e-18
SB_54448| Best HMM Match : RVT_1 (HMM E-Value=0.096)                   82   5e-16
SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34)                 81   1e-15
SB_32337| Best HMM Match : CaMBD (HMM E-Value=5.9)                     81   1e-15
SB_19821| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   1e-15
SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34)                  81   1e-15
SB_5327| Best HMM Match : zf-C2H2 (HMM E-Value=0.13)                   81   1e-15
SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42)             77   2e-14
SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11)                 77   2e-14
SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   2e-14
SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42)                  75   5e-14
SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3)                   75   7e-14
SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58)                    75   7e-14
SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.)              75   7e-14
SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.)              75   7e-14
SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3)                   75   7e-14
SB_29550| Best HMM Match : No HMM Matches (HMM E-Value=.)              75   7e-14
SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3)                   75   7e-14
SB_6390| Best HMM Match : BCL_N (HMM E-Value=8.4)                      75   9e-14
SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43)             74   1e-13
SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.)              74   1e-13
SB_28333| Best HMM Match : No HMM Matches (HMM E-Value=.)              74   2e-13
SB_24941| Best HMM Match : DPRP (HMM E-Value=1)                        74   2e-13
SB_46702| Best HMM Match : LETM1 (HMM E-Value=5.5)                     74   2e-13
SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43)             73   2e-13
SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30)                 73   2e-13
SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035)                   73   2e-13
SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.)              73   2e-13
SB_18732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13)                 73   2e-13
SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0)                       73   3e-13
SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43)             73   3e-13
SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06)         73   3e-13
SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3)                   73   3e-13
SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.)              73   3e-13
SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06)                 73   3e-13
SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.)              73   3e-13
SB_12170| Best HMM Match : RVT_1 (HMM E-Value=0.58)                    73   3e-13
SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.)               73   3e-13
SB_42325| Best HMM Match : RVT_1 (HMM E-Value=0.52)                    73   3e-13
SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58)                    73   3e-13
SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3)                    73   3e-13
SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.)              73   4e-13
SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2)                   73   4e-13
SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3)                    72   5e-13
SB_56583| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6)            71   1e-12
SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065)                 71   1e-12
SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4)                   71   2e-12
SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6)                   70   2e-12
SB_10362| Best HMM Match : No HMM Matches (HMM E-Value=.)              70   2e-12
SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6)                   70   2e-12
SB_41510| Best HMM Match : Minor_tail_Z (HMM E-Value=3.5)              70   3e-12
SB_40055| Best HMM Match : zf-C2H2 (HMM E-Value=0.13)                  70   3e-12
SB_32967| Best HMM Match : No HMM Matches (HMM E-Value=.)              70   3e-12
SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23)                 70   3e-12
SB_9519| Best HMM Match : zf-C2H2 (HMM E-Value=0.13)                   70   3e-12
SB_57364| Best HMM Match : No HMM Matches (HMM E-Value=.)              70   3e-12
SB_44220| Best HMM Match : No HMM Matches (HMM E-Value=.)              70   3e-12
SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37)                 70   3e-12
SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0)                        69   4e-12
SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.)              69   4e-12
SB_4898| Best HMM Match : CaMBD (HMM E-Value=1.2)                      69   5e-12
SB_28415| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)                69   5e-12
SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42)               69   5e-12
SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6)                   69   6e-12
SB_17856| Best HMM Match : No HMM Matches (HMM E-Value=.)              69   6e-12
SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.)               69   6e-12
SB_50765| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   8e-12
SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36)                   68   8e-12
SB_52360| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)                68   1e-11
SB_42604| Best HMM Match : DUF1196 (HMM E-Value=5)                     68   1e-11
SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36)                 68   1e-11
SB_58492| Best HMM Match : DUF1196 (HMM E-Value=5)                     67   1e-11
SB_24913| Best HMM Match : RVT_1 (HMM E-Value=1e-20)                   67   1e-11
SB_55051| Best HMM Match : RVT_1 (HMM E-Value=0.014)                   67   2e-11
SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   2e-11
SB_2372| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)                 67   2e-11
SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   3e-11
SB_2707| Best HMM Match : No HMM Matches (HMM E-Value=.)               66   3e-11
SB_10586| Best HMM Match : RVT_1 (HMM E-Value=0.039)                   66   4e-11
SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   6e-11
SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3)                   64   1e-10
SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3)                   64   1e-10
SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3)                   64   1e-10
SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46)                     64   1e-10
SB_47925| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   2e-10
SB_42199| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   2e-10
SB_14835| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)                64   2e-10
SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3)                    64   2e-10
SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   2e-10
SB_36804| Best HMM Match : tRNA_int_endo (HMM E-Value=3.9)             64   2e-10
SB_14108| Best HMM Match : zf-C2H2 (HMM E-Value=0.13)                  63   3e-10
SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   3e-10
SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.)               63   3e-10
SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1)                     63   3e-10
SB_29299| Best HMM Match : RVT_1 (HMM E-Value=0.00029)                 62   4e-10
SB_47792| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6)            62   4e-10
SB_9821| Best HMM Match : No HMM Matches (HMM E-Value=.)               62   4e-10
SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43)              62   5e-10
SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0)                       62   5e-10
SB_43040| Best HMM Match : L_lactis_RepB_C (HMM E-Value=3.4)           62   7e-10
SB_50753| Best HMM Match : zf-C2H2 (HMM E-Value=0.012)                 62   7e-10
SB_50090| Best HMM Match : SPC22 (HMM E-Value=2.8)                     62   7e-10
SB_25362| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6)            60   2e-09
SB_11573| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_10659| Best HMM Match : PAPA-1 (HMM E-Value=0.75)                   60   2e-09
SB_7036| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6)             60   2e-09
SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)                60   2e-09
SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   2e-09
SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   2e-09
SB_37284| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   3e-09
SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05)         60   3e-09
SB_52531| Best HMM Match : RVT_1 (HMM E-Value=1e-08)                   59   5e-09
SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0)                       59   5e-09
SB_24134| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6)            59   5e-09
SB_14815| Best HMM Match : RVT_1 (HMM E-Value=1.4)                     58   9e-09
SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085)                  58   1e-08
SB_19159| Best HMM Match : RVT_1 (HMM E-Value=0.00032)                 57   2e-08
SB_10529| Best HMM Match : zf-C2H2 (HMM E-Value=0.0034)                57   2e-08
SB_43443| Best HMM Match : Phage_fiber (HMM E-Value=3.8)               56   3e-08
SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3)                   56   4e-08
SB_13171| Best HMM Match : AT_hook (HMM E-Value=6.4)                   56   5e-08
SB_35729| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)                55   6e-08
SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3)                    55   8e-08
SB_56412| Best HMM Match : AT_hook (HMM E-Value=3.3)                   55   8e-08
SB_47109| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   8e-08
SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3)                   55   8e-08
SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3)                   55   8e-08
SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3)                   55   8e-08
SB_20661| Best HMM Match : DUF1274 (HMM E-Value=8.7)                   55   8e-08
SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3)                   55   8e-08
SB_14424| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)                54   1e-07
SB_263| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)                  54   1e-07
SB_54320| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_49315| Best HMM Match : Calreticulin (HMM E-Value=0)                54   1e-07
SB_50181| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)                54   2e-07
SB_59249| Best HMM Match : zf-C2H2 (HMM E-Value=0.016)                 52   4e-07
SB_41734| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   8e-07
SB_6304| Best HMM Match : RVT_1 (HMM E-Value=3.2e-18)                  51   1e-06
SB_49758| Best HMM Match : Sod_Fe_N (HMM E-Value=8.9)                  51   1e-06
SB_37101| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   1e-06
SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83)                  50   2e-06
SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83)                  50   2e-06
SB_13854| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07)               50   2e-06
SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1)                   50   2e-06
SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42)                  50   2e-06
SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3)                   50   2e-06
SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.)               50   2e-06
SB_42513| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12)                 50   3e-06
SB_18811| Best HMM Match : RVT_1 (HMM E-Value=0.075)                   50   3e-06
SB_8257| Best HMM Match : No HMM Matches (HMM E-Value=.)               49   4e-06
SB_8056| Best HMM Match : No HMM Matches (HMM E-Value=.)               49   5e-06
SB_46731| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11)                 49   5e-06
SB_38529| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   5e-06
SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   5e-06
SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21)                 48   7e-06
SB_40625| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   7e-06
SB_37650| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   7e-06
SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40)                 48   7e-06
SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3)                     48   7e-06
SB_16148| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   7e-06
SB_13918| Best HMM Match : RVT_1 (HMM E-Value=5.2e-07)                 48   7e-06
SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33)                    48   7e-06
SB_51607| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   7e-06
SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0)                       48   7e-06
SB_21468| Best HMM Match : RVT_1 (HMM E-Value=1.2)                     48   7e-06
SB_6135| Best HMM Match : CSD (HMM E-Value=5.4)                        48   7e-06
SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16)                  48   7e-06
SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0)                       48   9e-06
SB_59080| Best HMM Match : RVT_1 (HMM E-Value=1.2e-35)                 47   2e-05
SB_51188| Best HMM Match : RVT_1 (HMM E-Value=4.5e-24)                 47   2e-05
SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_28083| Best HMM Match : Uso1_p115_C (HMM E-Value=5.7)               46   3e-05
SB_21043| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   4e-05
SB_34098| Best HMM Match : RVT_1 (HMM E-Value=0)                       46   4e-05
SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3)                   46   4e-05
SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37)                 46   4e-05
SB_16378| Best HMM Match : DCX (HMM E-Value=0.7)                       46   4e-05
SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0)                       46   5e-05
SB_50593| Best HMM Match : KIX (HMM E-Value=8)                         46   5e-05
SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40)             45   7e-05
SB_28491| Best HMM Match : RVT_1 (HMM E-Value=0.00037)                 45   9e-05
SB_20057| Best HMM Match : RVT_1 (HMM E-Value=3e-13)                   45   9e-05
SB_5580| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   9e-05
SB_55435| Best HMM Match : RVT_1 (HMM E-Value=7.9e-22)                 44   1e-04
SB_13612| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_21258| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_19895| Best HMM Match : PHD (HMM E-Value=3.8e-08)                   44   1e-04
SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_29799| Best HMM Match : RVT_1 (HMM E-Value=3e-35)                   44   2e-04
SB_6031| Best HMM Match : RVT_1 (HMM E-Value=3.4)                      44   2e-04
SB_54945| Best HMM Match : AT_hook (HMM E-Value=3.3)                   44   2e-04
SB_46891| Best HMM Match : RVT_1 (HMM E-Value=1.6e-05)                 44   2e-04
SB_41944| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0)                       44   2e-04
SB_21595| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0)                       44   2e-04
SB_56322| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_53195| Best HMM Match : CaMBD (HMM E-Value=1.4)                     44   2e-04
SB_47325| Best HMM Match : RVT_1 (HMM E-Value=2.2e-31)                 44   2e-04
SB_5851| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   2e-04
SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22)                 43   3e-04
SB_3959| Best HMM Match : RVT_1 (HMM E-Value=6.4e-40)                  43   3e-04
SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21)                   43   4e-04
SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0)                       43   4e-04
SB_53026| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   4e-04
SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   4e-04
SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   4e-04
SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23)                 43   4e-04
SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   4e-04
SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   4e-04
SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7)                    42   5e-04
SB_42434| Best HMM Match : RVT_1 (HMM E-Value=2.7e-18)                 42   5e-04
SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08)                   42   5e-04
SB_45459| Best HMM Match : RVT_1 (HMM E-Value=6e-36)                   42   6e-04
SB_37313| Best HMM Match : AT_hook (HMM E-Value=3.3)                   42   6e-04
SB_33707| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_1380| Best HMM Match : RVT_1 (HMM E-Value=1.4e-38)                  42   6e-04
SB_58038| Best HMM Match : AT_hook (HMM E-Value=3.3)                   42   6e-04
SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23)                42   6e-04
SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_23124| Best HMM Match : AT_hook (HMM E-Value=3.3)                   42   6e-04
SB_1327| Best HMM Match : AT_hook (HMM E-Value=3.3)                    42   6e-04
SB_21106| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   8e-04
SB_52890| Best HMM Match : PH (HMM E-Value=1e-06)                      41   0.001
SB_27725| Best HMM Match : RVT_1 (HMM E-Value=1.9e-19)                 41   0.001
SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_47435| Best HMM Match : RVT_1 (HMM E-Value=7.8e-23)                 41   0.001
SB_10602| Best HMM Match : RVT_1 (HMM E-Value=1.3e-10)                 41   0.001
SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.)               41   0.001
SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36)                    41   0.001
SB_40332| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_36676| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45)              40   0.002
SB_29894| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031)                 40   0.002
SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_32853| Best HMM Match : RVT_1 (HMM E-Value=1.6)                     40   0.002
SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011)                 40   0.002
SB_11560| Best HMM Match : Peptidase_M1 (HMM E-Value=0)                40   0.002
SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_5302| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_270| Best HMM Match : PHD (HMM E-Value=0.0037)                      40   0.002
SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15)                 40   0.003
SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16)                 40   0.003
SB_50566| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_45791| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.2)           40   0.003
SB_43890| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_40223| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_36818| Best HMM Match : RVT_1 (HMM E-Value=8e-35)                   40   0.003
SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0)                       40   0.003
SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40)                 40   0.003
SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011)                   40   0.003
SB_20480| Best HMM Match : RVT_1 (HMM E-Value=0.00014)                 40   0.003
SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015)                   40   0.003
SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_48616| Best HMM Match : RVT_1 (HMM E-Value=2.8e-26)                 40   0.003
SB_48077| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_45064| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0)                       40   0.003
SB_8130| Best HMM Match : RVT_1 (HMM E-Value=8e-35)                    40   0.003
SB_4423| Best HMM Match : 7tm_1 (HMM E-Value=5.5e-08)                  40   0.003
SB_3856| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0)                       39   0.004
SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072)                   39   0.004
SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36)                   39   0.004
SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33)                    39   0.004
SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0)                       39   0.004
SB_31122| Best HMM Match : RVT_1 (HMM E-Value=0.0033)                  39   0.004
SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049)                  39   0.004
SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0)                       39   0.004
SB_32869| Best HMM Match : Toxin_7 (HMM E-Value=3.9)                   39   0.006
SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35)                   39   0.006
SB_31784| Best HMM Match : RVT_1 (HMM E-Value=2e-35)                   39   0.006
SB_21953| Best HMM Match : UME (HMM E-Value=6.1)                       39   0.006
SB_8124| Best HMM Match : Ribosomal_L16 (HMM E-Value=0.55)             39   0.006
SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.006
SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.008
SB_36078| Best HMM Match : F5_F8_type_C (HMM E-Value=2.1e-27)          38   0.008
SB_32772| Best HMM Match : AT_hook (HMM E-Value=2.6)                   38   0.008
SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028)                   38   0.008
SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0)                        38   0.008
SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.008
SB_42505| Best HMM Match : RVT_1 (HMM E-Value=3.9e-18)                 38   0.008
SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.008
SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.008
SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0)                       38   0.008
SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0)                       38   0.008
SB_10154| Best HMM Match : RVT_1 (HMM E-Value=4.3e-17)                 38   0.008
SB_3153| Best HMM Match : PAN (HMM E-Value=0.0028)                     38   0.008
SB_51570| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.010
SB_36682| Best HMM Match : RVT_1 (HMM E-Value=0.0067)                  38   0.010
SB_25070| Best HMM Match : RVT_1 (HMM E-Value=1.4e-15)                 38   0.010
SB_59259| Best HMM Match : AT_hook (HMM E-Value=2.6)                   38   0.010
SB_56675| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-08)         38   0.010
SB_55170| Best HMM Match : RVT_1 (HMM E-Value=0.16)                    38   0.010
SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32)                 38   0.010
SB_36757| Best HMM Match : RVT_1 (HMM E-Value=4.1e-28)                 38   0.010
SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42)             38   0.010
SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41)             38   0.010
SB_11864| Best HMM Match : RVT_1 (HMM E-Value=0.012)                   38   0.013
SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.013
SB_3017| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19)                  38   0.013
SB_47691| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.018
SB_40707| Best HMM Match : RVT_1 (HMM E-Value=0.17)                    37   0.018
SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15)                 37   0.018
SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34)                 37   0.018
SB_20474| Best HMM Match : DUF1505 (HMM E-Value=5.7)                   37   0.018
SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)              37   0.018
SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)               37   0.018
SB_41699| Best HMM Match : RVT_1 (HMM E-Value=1.90002e-41)             37   0.018
SB_32833| Best HMM Match : RVT_1 (HMM E-Value=2)                       37   0.018
SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39)                 37   0.018
SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)              37   0.018
SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28)                    37   0.023
SB_25600| Best HMM Match : RVT_1 (HMM E-Value=0.0074)                  37   0.023
SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.023
SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04)                    36   0.031
SB_19708| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.031
SB_32204| Best HMM Match : wnt (HMM E-Value=8.2e-31)                   36   0.031
SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.)               36   0.041
SB_47521| Best HMM Match : RVT_1 (HMM E-Value=7.2e-24)                 36   0.041
SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.041
SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.054
SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.054
SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23)                   36   0.054
SB_7055| Best HMM Match : RVT_1 (HMM E-Value=0.00051)                  36   0.054
SB_41541| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17)                 35   0.071
SB_51815| Best HMM Match : RVT_1 (HMM E-Value=0.23)                    35   0.094
SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.094
SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1)                     35   0.094
SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.094
SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18)                 35   0.094
SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4)                       35   0.094
SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.094
SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4)                        35   0.094
SB_4509| Best HMM Match : Brix (HMM E-Value=4.4)                       35   0.094
SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1)                      35   0.094
SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.094
SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23)                 35   0.094
SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99)                    35   0.094
SB_3880| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.094
SB_35162| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.12 
SB_21609| Best HMM Match : Peptidase_M23 (HMM E-Value=5.7)             34   0.12 
SB_44324| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.12 
SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.12 
SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.12 
SB_7760| Best HMM Match : Peptidase_M23 (HMM E-Value=5.7)              34   0.12 
SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.16 
SB_57527| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.16 
SB_32202| Best HMM Match : RVT_1 (HMM E-Value=0.1)                     34   0.16 
SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.22 
SB_27910| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.22 
SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.22 
SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45)              33   0.29 
SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0)                       33   0.29 
SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11)                 33   0.29 
SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44)             33   0.29 
SB_28319| Best HMM Match : zf-C2H2 (HMM E-Value=0.012)                 33   0.29 
SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.29 
SB_21594| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.29 
SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0)                       33   0.29 
SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0)                        33   0.29 
SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5)                     33   0.29 
SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15)                 33   0.29 
SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45)             33   0.29 
SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18)                 33   0.29 
SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.29 
SB_7440| Best HMM Match : fn3 (HMM E-Value=0.35)                       33   0.29 
SB_55618| Best HMM Match : RVT_1 (HMM E-Value=0.12)                    33   0.38 
SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.38 
SB_27212| Best HMM Match : zf-C2H2 (HMM E-Value=0.42)                  33   0.38 
SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14)                   33   0.38 
SB_20409| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.38 
SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022)                   32   0.50 
SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11)                 32   0.50 
SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.50 
SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39)                 32   0.50 
SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.50 
SB_59615| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.66 
SB_37794| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.66 
SB_34933| Best HMM Match : RVT_1 (HMM E-Value=3.5e-08)                 32   0.66 
SB_23472| Best HMM Match : HIT (HMM E-Value=0.43)                      32   0.66 
SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8)                     32   0.66 
SB_55944| Best HMM Match : RVT_1 (HMM E-Value=1.6e-11)                 32   0.66 
SB_5957| Best HMM Match : Chitin_synth_1 (HMM E-Value=9)               32   0.66 
SB_2811| Best HMM Match : No HMM Matches (HMM E-Value=.)               32   0.66 
SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.87 
SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7)            31   0.87 
SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07)                 31   0.87 
SB_20464| Best HMM Match : RVT_1 (HMM E-Value=0.016)                   31   0.87 
SB_9841| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.87 
SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13)                  31   0.87 
SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.2  
SB_29603| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.2  
SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066)                  31   1.2  
SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0)                       31   1.2  
SB_3345| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.2  
SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10)         31   1.2  
SB_27259| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.2  
SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.2  
SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28)                 31   1.2  
SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38)                 31   1.2  
SB_6574| Best HMM Match : eIF-6 (HMM E-Value=1.60028e-42)              31   1.2  
SB_58643| Best HMM Match : RhoGAP (HMM E-Value=3.7)                    31   1.5  
SB_42670| Best HMM Match : RVT_1 (HMM E-Value=5.6e-27)                 31   1.5  
SB_40620| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.5  
SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03)                    31   1.5  
SB_21856| Best HMM Match : RVT_1 (HMM E-Value=4.5e-32)                 31   1.5  
SB_567| Best HMM Match : RVT_1 (HMM E-Value=8.3e-05)                   31   1.5  
SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.5  
SB_51970| Best HMM Match : LacAB_rpiB (HMM E-Value=9.7)                31   1.5  
SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.5  
SB_23136| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.5  
SB_21912| Best HMM Match : RhoGAP (HMM E-Value=3.7)                    31   1.5  
SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082)                  31   1.5  
SB_7145| Best HMM Match : RVT_1 (HMM E-Value=3.8e-25)                  31   1.5  
SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22)                  31   1.5  
SB_267| Best HMM Match : RhoGAP (HMM E-Value=3.7)                      31   1.5  
SB_51225| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.0  
SB_50245| Best HMM Match : RVT_1 (HMM E-Value=1.4e-16)                 30   2.0  
SB_49546| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.0  
SB_19870| Best HMM Match : RVT_1 (HMM E-Value=0.18)                    30   2.0  
SB_1766| Best HMM Match : Nodulin_late (HMM E-Value=7.2)               30   2.0  
SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007)                  30   2.0  
SB_52705| Best HMM Match : RnaseA (HMM E-Value=1.4)                    30   2.0  
SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4)             30   2.0  
SB_21337| Best HMM Match : RnaseA (HMM E-Value=1.1)                    30   2.0  
SB_56622| Best HMM Match : ImpA-rel_N (HMM E-Value=1)                  30   2.7  
SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0)                       30   2.7  
SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_46530| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_39090| Best HMM Match : zf-piccolo (HMM E-Value=0.81)               30   2.7  
SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0)                       30   2.7  
SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24)                 30   2.7  
SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13)                 30   2.7  
SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094)                  30   2.7  
SB_26381| Best HMM Match : RVT_1 (HMM E-Value=0.2)                     30   2.7  
SB_25411| Best HMM Match : CDO_I (HMM E-Value=8.6e-06)                 30   2.7  
SB_22340| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_21429| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_8667| Best HMM Match : SAP (HMM E-Value=2.3)                        30   2.7  
SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.)                30   2.7  
SB_51268| Best HMM Match : SAP (HMM E-Value=2.3)                       30   2.7  
SB_37579| Best HMM Match : SAP (HMM E-Value=2.3)                       30   2.7  
SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0)                       30   2.7  
SB_33259| Best HMM Match : RVT_1 (HMM E-Value=4.3e-12)                 30   2.7  
SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0)                       30   2.7  
SB_27893| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0)                       30   2.7  
SB_16012| Best HMM Match : Glyco_hydro_20 (HMM E-Value=0)              30   2.7  
SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.7  
SB_7810| Best HMM Match : RVT_1 (HMM E-Value=2.8026e-45)               30   2.7  
SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   2.7  
SB_534| Best HMM Match : No HMM Matches (HMM E-Value=.)                30   2.7  
SB_45433| Best HMM Match : DUF1187 (HMM E-Value=4.3)                   29   3.5  
SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085)                  29   3.5  
SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17)                 29   3.5  
SB_32784| Best HMM Match : RVT_1 (HMM E-Value=3.9e-26)                 29   3.5  
SB_30073| Best HMM Match : RVT_1 (HMM E-Value=3e-26)                   29   3.5  
SB_27763| Best HMM Match : VapD_N (HMM E-Value=10)                     29   3.5  
SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_45260| Best HMM Match : RVT_1 (HMM E-Value=1.2)                     29   3.5  
SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     29   3.5  
SB_41512| Best HMM Match : SAP (HMM E-Value=2.3)                       29   3.5  
SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20)                 29   3.5  
SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_20766| Best HMM Match : VapD_N (HMM E-Value=10)                     29   3.5  
SB_19415| Best HMM Match : LON (HMM E-Value=4.4)                       29   4.6  
SB_26251| Best HMM Match : RVT_1 (HMM E-Value=0.0014)                  29   4.6  
SB_21608| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.6  
SB_56299| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.1  
SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26)                 29   6.1  
SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26)                 29   6.1  

>SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38)
          Length = 492

 Score =  149 bits (361), Expect = 3e-36
 Identities = 79/177 (44%), Positives = 111/177 (62%), Gaps = 3/177 (1%)
 Frame = -3

Query: 522 SGDNTR-GIEWSE-NILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTV 349
           S D  R GI+W+    L+DLD+A+D+ L++ T  QMQ K   +  ++ + GL IN  K+ 
Sbjct: 211 STDQKRNGIQWTLWKQLDDLDFANDLALLSHTQQQMQEKTNIVADNSARLGLNINRGKSK 270

Query: 348 DMRVMSKNTTPLKLQDCGFE-VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPV 172
             +  + N TP+ +Q    E V T  Y+ G +L  QGG+D DI  RI KAR AF QLK +
Sbjct: 271 VFKTNASNETPITVQGEALEEVDTFTYL-GSILDKQGGTDADIRTRIGKARAAFHQLKNI 329

Query: 171 WESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFWP 1
           W SS ++   K+ LF++IVK +LL+G ETWR T T   ++QVF+N CLR IL+I WP
Sbjct: 330 WGSSEISITTKIRLFNTIVKPILLYGAETWRTTVTTMKKIQVFINTCLRKILKIRWP 386



 Score = 69.3 bits (162), Expect = 4e-12
 Identities = 36/81 (44%), Positives = 50/81 (61%), Gaps = 1/81 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           ++  G+P KI  II+  Y G TCRVVH + L    E+  GV+QGCLLSP LF++ +D IM
Sbjct: 149 MRHYGVPEKITNIIRKSYEGMTCRVVHGRQLTDAFEIRTGVRQGCLLSPFLFLLAIDWIM 208

Query: 527 REVVTTLGALNGAKIS-WKTL 468
           +   +T    NG + + WK L
Sbjct: 209 K--TSTDQKRNGIQWTLWKQL 227


>SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1054

 Score =  144 bits (350), Expect = 6e-35
 Identities = 78/177 (44%), Positives = 109/177 (61%), Gaps = 3/177 (1%)
 Frame = -3

Query: 522  SGDNTR-GIEWSE-NILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTV 349
            S D  R GI+W+    L+DLD+ADD+ L++ T  QMQ K   +  ++ + GL IN  K+ 
Sbjct: 783  STDQKRNGIQWTLWKQLDDLDFADDLALLSHTQQQMQEKTNIVADNSARLGLNINRGKSK 842

Query: 348  DMRVMSKNTTPLKLQDCGFE-VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPV 172
              +  + N TP+ +Q    E V T  Y+ G +L NQGG D DI  RI KAR AF Q+K +
Sbjct: 843  VFKTNASNETPITVQGEALEEVDTFTYL-GSILDNQGGKDADIRTRIGKARAAFHQIKNI 901

Query: 171  WESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFWP 1
            W SS ++   K+ LF++I+K +LL+G ETWR T T   ++QVF+N CLR ILR   P
Sbjct: 902  WGSSEISITTKIRLFNTIIKPILLYGAETWRNTVTTMKKIQVFINTCLRKILRSAGP 958



 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  G+  KI  II+  Y G TCRVVH + L    E+  GV+QGCLLSP LF++ +D IM
Sbjct: 721 LRHYGVSEKITNIIRKSYEGMTCRVVHGRQLTDAFEIRTGVRQGCLLSPFLFLLAIDWIM 780

Query: 527 REVVTTLGALNGAKIS-WKTL 468
           +   +T    NG + + WK L
Sbjct: 781 K--TSTDQKRNGIQWTLWKQL 799


>SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08)
          Length = 421

 Score =  144 bits (350), Expect = 6e-35
 Identities = 78/177 (44%), Positives = 109/177 (61%), Gaps = 3/177 (1%)
 Frame = -3

Query: 522 SGDNTR-GIEWSE-NILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTV 349
           S D  R GI+W+    L+DLD+ADD+ L++ T  QMQ K   +  ++ + GL IN  K+ 
Sbjct: 139 STDQKRNGIQWTLWKQLDDLDFADDLALLSHTQQQMQEKTNIVADNSARLGLNINRGKSK 198

Query: 348 DMRVMSKNTTPLKLQDCGFE-VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPV 172
             +  + N TP+ +Q    E V T  Y+ G +L NQGG D DI  RI KAR AF Q+K +
Sbjct: 199 VFKTNASNETPITVQGEALEEVDTFTYL-GSILDNQGGKDADIRTRIGKARAAFHQIKNI 257

Query: 171 WESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFWP 1
           W SS ++   K+ LF++I+K +LL+G ETWR T T   ++QVF+N CLR ILR   P
Sbjct: 258 WGSSEISITTKIRLFNTIIKPILLYGAETWRNTVTTMKKIQVFINTCLRKILRSAGP 314



 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  G+  KI  II+  Y G TCRVVH + L    E+  GV+QGCLLSP LF++ +D IM
Sbjct: 77  LRHYGVSEKITNIIRKSYEGMTCRVVHGRQLTDAFEIRTGVRQGCLLSPFLFLLAIDWIM 136

Query: 527 REVVTTLGALNGAKIS-WKTL 468
           +   +T    NG + + WK L
Sbjct: 137 K--TSTDQKRNGIQWTLWKQL 155


>SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 537

 Score =  138 bits (333), Expect = 7e-33
 Identities = 78/177 (44%), Positives = 108/177 (61%), Gaps = 3/177 (1%)
 Frame = -3

Query: 522 SGDNTR-GIEWSE-NILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTV 349
           S D  R GI+W+    L+DLD+AD + L+  T  QMQ K   +  ++ K GL IN  K+ 
Sbjct: 317 STDQKRNGIQWTLWKQLDDLDFAD-LALLFHTQQQMQEKTNIVADNSAKLGLNINRGKSK 375

Query: 348 DMRVMSKNTTPLKLQ-DCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPV 172
             +  + N TP+ +Q +   EV T  Y+ G +L  QGG+D DI  RI KAR AF QLK +
Sbjct: 376 MFKTNASNETPITVQGETLEEVDTFTYL-GSILDKQGGTDADIRTRIGKARAAFHQLKNI 434

Query: 171 WESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFWP 1
           W SS ++   K+ LF++IVK +LL+G ETWR T     ++ VF+N CLR IL+I WP
Sbjct: 435 WGSSEISITTKIRLFNTIVKPILLYGAETWRNTVITMKKIPVFINTCLRKILKIRWP 491



 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  G+P KI  II+  Y   TCRVVH + L    E+  GV+QGCLLSP LF++ +D IM
Sbjct: 255 LRHYGVPEKITNIIRKSYEEMTCRVVHGRQLTDAFEIRTGVRQGCLLSPFLFLLAIDWIM 314

Query: 527 REVVTTLGALNGAKIS-WKTL 468
           +   +T    NG + + WK L
Sbjct: 315 K--TSTDQKRNGIQWTLWKQL 333


>SB_29934| Best HMM Match : Vicilin_N (HMM E-Value=1.4)
          Length = 290

 Score =  129 bits (311), Expect = 3e-30
 Identities = 68/177 (38%), Positives = 100/177 (56%), Gaps = 1/177 (0%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G G+N  GI W   + L+DLD+ADDI L++ T    Q K   L   A + GL+IN  K
Sbjct: 8   SVGKGEN--GIRWKFTSKLDDLDFADDIALLSSTKHHCQEKTAKLDGEARREGLKINLEK 65

Query: 354 TVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP 175
           T  +R+ +K    + +     E  +E    G  +  +GG  +D+  R+ KAR  + +LK 
Sbjct: 66  TKMLRINAKQHGNIVINGKEIEDVSEFTYLGAKVCREGGGMKDLRNRLSKARSVYTRLKR 125

Query: 174 VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +W S  +T R K+ ++ S+V SVLL+GCETW++ K     L VF  KCLR IL+I W
Sbjct: 126 IWNSKKITIRTKIKIYKSLVLSVLLYGCETWKMNKKDDKLLDVFQQKCLRRILKISW 182


>SB_31729| Best HMM Match : RVT_1 (HMM E-Value=0.023)
          Length = 423

 Score =  128 bits (310), Expect = 4e-30
 Identities = 67/150 (44%), Positives = 92/150 (61%), Gaps = 1/150 (0%)
 Frame = -3

Query: 447 LMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFE-VSTEVY 271
           L++ T  QMQ K   +  ++ + GL IN  KT   +  + N TP+ +Q    E V T  Y
Sbjct: 229 LLSHTQQQMQEKANIVADNSARLGLNINRGKTKVFKTNASNETPITVQGEALEEVDTFTY 288

Query: 270 ISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGC 91
           + G +L  QGG+D DI  RI KAR AF QLK +W SS ++   K+ LF++IVK +LL+G 
Sbjct: 289 L-GSILDKQGGTDADIRTRIGKARAAFHQLKNIWGSSEISITTKIRLFNTIVKPILLYGA 347

Query: 90  ETWRVTKTLTNRLQVFVNKCLRSILRIFWP 1
           ETWR T     ++QVF+N CLR IL+I WP
Sbjct: 348 ETWRNTVITMKKIQVFINTCLRKILKIRWP 377


>SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 226

 Score =  126 bits (305), Expect = 2e-29
 Identities = 65/143 (45%), Positives = 89/143 (62%), Gaps = 1/143 (0%)
 Frame = -3

Query: 426 QMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFE-VSTEVYISGELLS 250
           QMQ K   +  +A + GL IN  K+   +  + N TP+ +Q    E V T  Y+ G +L 
Sbjct: 26  QMQEKTNIVADNAARLGLNINRGKSKVFKTNASNETPITVQGEALEEVDTFTYL-GSILD 84

Query: 249 NQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTK 70
           NQGG+D DI  RI KA  AF QLK +W SS ++   K+ LF++I+K +LL+G ETWR T 
Sbjct: 85  NQGGTDADIRTRIGKALAAFHQLKNIWGSSEISITTKIRLFNTIIKPILLYGAETWRNTV 144

Query: 69  TLTNRLQVFVNKCLRSILRIFWP 1
           T   ++QVF+N CLR IL+I WP
Sbjct: 145 TTMKKIQVFINTCLRKILKIRWP 167


>SB_28986| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score =  125 bits (302), Expect = 4e-29
 Identities = 67/177 (37%), Positives = 100/177 (56%), Gaps = 1/177 (0%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G G+N  GI+W   + L+DLD+ADDI L++ T   +Q K   L   A + GL+IN  K
Sbjct: 365 SVGKGEN--GIQWKFTSKLDDLDFADDIALLSSTKHHIQEKTAKLDGEARRAGLKINLEK 422

Query: 354 TVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP 175
           T  +R+ +K    + +     E  +E    G  +  +GG  +D+  R+ KAR  + +LK 
Sbjct: 423 TKMLRINAKQYGNIVINGKEIEDVSEFTYLGAKVCREGGGMKDLRNRLSKARSVYTRLKR 482

Query: 174 VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +W S  + RR K+ L+  +V SVLL+GCETW++ K     L VF  K LR IL+I W
Sbjct: 483 IWNSKKIMRRTKIKLYKPLVLSVLLYGCETWKMNKKDDKLLDVFQQKYLRRILKISW 539



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 25/87 (28%), Positives = 48/87 (55%)
 Frame = -1

Query: 776 FLRLLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEM 597
           ++  + FEK+  +++  +     +++ G+P KII I++  Y    C V     +G    +
Sbjct: 281 YVNFIDFEKAFDSVHRES-LWVIMEKYGVPEKIIRIVRLFYEDFQCAVEDQGKIGEWFNI 339

Query: 596 TAGVKQGCLLSPLLFIMLLDDIMREVV 516
             GVKQGC +S  +F++++D I+R  V
Sbjct: 340 KTGVKQGCNMSGFIFLLVMDWILRRSV 366


>SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25)
          Length = 1641

 Score =  123 bits (297), Expect = 2e-28
 Identities = 72/177 (40%), Positives = 103/177 (58%), Gaps = 3/177 (1%)
 Frame = -3

Query: 522 SGDNTR-GIEWSE-NILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTV 349
           S D  R GI+W+    L+ LD+ADD+ L++ T  QMQ K   +  +A + GL IN  K+ 
Sbjct: 337 STDQKRNGIQWTLWKQLDYLDFADDLALLSHTQQQMQEKTNIVADNAARLGLNINRGKSK 396

Query: 348 DMRVMSKNTTPLKLQDCGFE-VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPV 172
             +  + N TP+ +Q    E V T  Y+ G +L NQGG+D DI  RI            +
Sbjct: 397 VFKTNASNETPITVQGEALEEVDTFTYL-GSILDNQGGTDADIRTRIE-----------L 444

Query: 171 WESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFWP 1
           W SS ++   K+ LF++I+K +LL+G ETWR T T   ++QVF+N CLR IL+I WP
Sbjct: 445 WGSSEISITTKIRLFNTIIKPILLYGAETWRNTVTTMKKIQVFINTCLRKILKIRWP 501



 Score =  121 bits (292), Expect = 6e-28
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 1/142 (0%)
 Frame = -3

Query: 423 MQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFE-VSTEVYISGELLSN 247
           MQ K   +  +A + GL IN  K+   +  + N T + +Q    E V T  Y+ G +L N
Sbjct: 1   MQEKTNIVADNAARLGLNINRGKSKVFKTNASNETXITVQGEALEEVDTFTYL-GSILDN 59

Query: 246 QGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKT 67
           QGG+D DI  RI KA  AF QLK +W SS ++   K+ LF++I+K +LL+G ETWR T T
Sbjct: 60  QGGTDADIRTRIGKALAAFHQLKNIWGSSEISITTKIRLFNTIIKPILLYGAETWRNTVT 119

Query: 66  LTNRLQVFVNKCLRSILRIFWP 1
              ++QVF+N CLR IL+I WP
Sbjct: 120 TMKKIQVFINTCLRKILKIRWP 141



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 31/81 (38%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  G+  KI  II+  Y G TC            E+  GV+QGCLLSP LF++ +D IM
Sbjct: 283 LRHYGVSEKITNIIRKSYEGMTCITA--------FEIRTGVRQGCLLSPFLFLLAIDWIM 334

Query: 527 REVVTTLGALNGAKIS-WKTL 468
           +   +T    NG + + WK L
Sbjct: 335 K--TSTDQKRNGIQWTLWKQL 353


>SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23)
          Length = 385

 Score =  119 bits (287), Expect = 3e-27
 Identities = 70/176 (39%), Positives = 100/176 (56%), Gaps = 2/176 (1%)
 Frame = -3

Query: 522 SGDNTRGIEWSENILEDL-DYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVD 346
           + D TRGI+ +  +   L D+ADD+  ++   D +Q K + L   + + G  INT K   
Sbjct: 169 TSDKTRGIQLT--LFSHLEDFADDLAALSSRSDHVQEKTDRLEQFSSQTGRHINTTK--- 223

Query: 345 MRVMSKNTTPLKLQDCGFEVSTEVYIS-GELLSNQGGSDEDIEIRIRKARGAFAQLKPVW 169
                KN  P+ +Q    E S E + S G L+S   G+ +DI  R+ KARG FA+L P+W
Sbjct: 224 -----KNPLPITIQGKVLE-SVEKFTSLGSLISKDNGAKKDILSRLGKARGTFARLNPIW 277

Query: 168 ESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFWP 1
           +S   + + KL L++S VKSVLL+G E WRV K   +++  F N CLR I  IFWP
Sbjct: 278 KSKQYSLKTKLRLYNSNVKSVLLYGSECWRVVKADMDKISAFHNGCLRKICHIFWP 333



 Score = 37.1 bits (82), Expect = 0.018
 Identities = 14/32 (43%), Positives = 23/32 (71%)
 Frame = -1

Query: 608 PIEMTAGVKQGCLLSPLLFIMLLDDIMREVVT 513
           P  +  GV+QGC+ SP+LF++ +D IMR+  +
Sbjct: 139 PFPVNFGVRQGCIHSPILFLVAIDWIMRQTTS 170


>SB_51049| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score =  116 bits (278), Expect = 3e-26
 Identities = 58/127 (45%), Positives = 81/127 (63%), Gaps = 1/127 (0%)
 Frame = -3

Query: 378 GLRINTNKTVDMRVMSKNTTPLKLQDCGFE-VSTEVYISGELLSNQGGSDEDIEIRIRKA 202
           G + +  K+   +  + N TP+ +Q    E V T  Y+ G +L NQGG+D DI  RI KA
Sbjct: 15  GPQHHRGKSKVFKTNASNETPITVQGEALEEVDTFTYL-GSILDNQGGTDADIRTRIGKA 73

Query: 201 RGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRS 22
           R AF QLK +W SS ++   K+ LF++I+K +LL+G ETWR T T   ++QVF+N CLR 
Sbjct: 74  RAAFHQLKNIWGSSEISITTKIRLFNTIIKPILLYGAETWRNTVTTMKKIQVFINTCLRK 133

Query: 21  ILRIFWP 1
           IL+I WP
Sbjct: 134 ILKIRWP 140


>SB_13911| Best HMM Match : PAN (HMM E-Value=0.033)
          Length = 534

 Score =  109 bits (263), Expect = 2e-24
 Identities = 62/155 (40%), Positives = 91/155 (58%), Gaps = 3/155 (1%)
 Frame = -3

Query: 522 SGDNTR-GIEWSE-NILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTV 349
           S D  R GI+W+    L+D D+ADD+  ++ T  Q+Q K   +  ++ + GL IN  K+ 
Sbjct: 103 STDQKRNGIQWTLWKQLDDFDFADDLAFLSHTQQQIQEKTNFVADNSARLGLNINRGKSK 162

Query: 348 DMRVMSKNTTPLKLQDCGFE-VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPV 172
             +  + + TP+ +Q    E V T  Y+ G +L  QGG+D DI  RI KAR A  QLK +
Sbjct: 163 MFKTNASSETPITVQGEALEEVDTFTYL-GSILDKQGGTDADIRTRIGKARAALHQLKNI 221

Query: 171 WESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKT 67
           W SS ++   K+ LF++ VK +LL+G ETWR T T
Sbjct: 222 WGSSEISITTKIRLFNTTVKPILLYGAETWRNTVT 256



 Score = 69.3 bits (162), Expect = 4e-12
 Identities = 37/81 (45%), Positives = 50/81 (61%), Gaps = 1/81 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  G+P KI  II+  Y G TCRVVH + L    E+  GV+QGCLLSP LF++ +D IM
Sbjct: 41  LRHYGVPEKITNIIRKSYEGMTCRVVHGRQLIDAFEIRTGVRQGCLLSPFLFLLAIDWIM 100

Query: 527 REVVTTLGALNGAKIS-WKTL 468
           +   +T    NG + + WK L
Sbjct: 101 K--TSTDQKRNGIQWTLWKQL 119


>SB_57155| Best HMM Match : RTP (HMM E-Value=4.2)
          Length = 237

 Score = 93.5 bits (222), Expect = 2e-19
 Identities = 48/125 (38%), Positives = 74/125 (59%), Gaps = 1/125 (0%)
 Frame = -3

Query: 375 LRINTNKTVDMRVMSKNTTPLKLQDCG-FEVSTEVYISGELLSNQGGSDEDIEIRIRKAR 199
           LRIN  +  ++ +  K     +++D G F  + +  + G  +  +GG  +D+  R+ KAR
Sbjct: 2   LRINAKQHGNIVINGK-----EIEDVGKFTFTEQNGVYGAKVCREGGGMKDLRNRLSKAR 56

Query: 198 GAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSI 19
           G + +LK +W S  + RR K+ L+ S+V SVLL+GCETW++ K     L VF  KCLR I
Sbjct: 57  GVYTRLKRIWNSKKIMRRTKINLYKSLVLSVLLYGCETWKMNKKDDKLLDVFQQKCLRRI 116

Query: 18  LRIFW 4
           L+I W
Sbjct: 117 LKISW 121


>SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33)
          Length = 585

 Score = 91.1 bits (216), Expect = 1e-18
 Identities = 62/177 (35%), Positives = 90/177 (50%), Gaps = 3/177 (1%)
 Frame = -3

Query: 522 SGDNTR-GIEWSE-NILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTV 349
           S D  R GI+W+    L+DLD+A+D+ L++ T  QMQ K   +  ++ + GL IN  K  
Sbjct: 279 STDQKRNGIQWTLWKQLDDLDFANDLALLSHTQQQMQEKTNIVADNSARLGLNINRGK-- 336

Query: 348 DMRVMSKNTTPLKLQ-DCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPV 172
                SK     ++Q D            G        S    E R+  +  A      +
Sbjct: 337 -----SKGVQAKRIQRDTHHSPRRGAGRGGTPSPTSAASWTSREERMPTSEPALN----I 387

Query: 171 WESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFWP 1
           W SS ++   K+ LF++IVK +LL+G ETWR T T   ++QVF+N CLR IL+I WP
Sbjct: 388 WGSSEISITTKIRLFNTIVKPILLYGAETWRTTVTTMKKIQVFINTCLRKILKIRWP 444



 Score = 69.3 bits (162), Expect = 4e-12
 Identities = 36/81 (44%), Positives = 50/81 (61%), Gaps = 1/81 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           ++  G+P KI  II+  Y G TCRVVH + L    E+  GV+QGCLLSP LF++ +D IM
Sbjct: 217 MRHYGVPEKITNIIRKSYEGMTCRVVHGRQLTDAFEIRTGVRQGCLLSPFLFLLAIDWIM 276

Query: 527 REVVTTLGALNGAKIS-WKTL 468
           +   +T    NG + + WK L
Sbjct: 277 K--TSTDQKRNGIQWTLWKQL 295


>SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 302

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 70/210 (33%), Positives = 103/210 (49%), Gaps = 34/210 (16%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQ---AKLED------LRISAEK 382
           + G G+N  GI W   + L+DLD+AD+I L+  T   +Q   AKL+       L+I+ EK
Sbjct: 62  SVGKGEN--GIRWKFTSKLDDLDFADNIALLCSTKHHIQEKTAKLDGEARRAGLKINLEK 119

Query: 381 -RGLRINTNK-----------------------TVDMRVMSKNTTPLKLQDCGFEVSTEV 274
            + LRIN  +                         D +V  K  T + +     E  +E 
Sbjct: 120 TKMLRINAKQHGNIVMFGIPVSINNESPPLLFIRFDPKVFLKYITNIVINGKEIEDVSEF 179

Query: 273 YISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFG 94
              G  +  +GG  +D+  R+ KAR  + +LK +  S  + RR K+ L+  +V SVLL+G
Sbjct: 180 TYLGAKVCREGGGMKDLRNRLSKARSVYTRLKRICNSKKIMRRTKIKLYKPLVLSVLLYG 239

Query: 93  CETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           CETW++ K     L VF  KCLR IL+I W
Sbjct: 240 CETWKMNKKDDKLLDVFQQKCLRRILKISW 269



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/64 (32%), Positives = 37/64 (57%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +++ G+P +II I++  Y    C V     +G    +  GVKQGC +S  +F++++D I+
Sbjct: 1   MEKYGVP-EIIRIVRLFYGDFQCAVEDQGEIGEWFNIKTGVKQGCNMSGFMFLLVMDWIL 59

Query: 527 REVV 516
           R  V
Sbjct: 60  RRSV 63


>SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044)
          Length = 647

 Score = 89.4 bits (212), Expect = 3e-18
 Identities = 51/143 (35%), Positives = 78/143 (54%), Gaps = 1/143 (0%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G G+N  GI W   + L DLD+ADDIVL++ T   +Q K   L   A + GL+IN  K
Sbjct: 481 SVGKGEN--GIRWKFTSKLGDLDFADDIVLLSSTKHHIQEKTAKLDGKARQAGLKINLEK 538

Query: 354 TVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP 175
           T  +R+ +K    + +     E  +E    G  +  QGG  +D+  R+ KAR  + +LK 
Sbjct: 539 TKMLRINAKQHGNIVINGKEIEDVSEFTYLGAKVCRQGGGMKDLRNRLSKARSVYTRLKR 598

Query: 174 VWESSVMTRRIKLTLFDSIVKSV 106
           +W S  + RR K+ ++ S+V SV
Sbjct: 599 IWNSKKIMRRTKIKIYKSLVLSV 621



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 20/64 (31%), Positives = 36/64 (56%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +++ G+  KII I++  Y    C V     +G    +  G+KQGC +S  +F++++D I+
Sbjct: 419 MEKYGVQEKIICIVRLFYEDFQCAVEDQGEIGEWFNIKTGIKQGCNMSGFMFLLVMDWIL 478

Query: 527 REVV 516
           R  V
Sbjct: 479 RRSV 482


>SB_54448| Best HMM Match : RVT_1 (HMM E-Value=0.096)
          Length = 343

 Score = 82.2 bits (194), Expect = 5e-16
 Identities = 54/169 (31%), Positives = 85/169 (50%), Gaps = 7/169 (4%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSK 328
           E ++ DL +ADD  L       MQ +++    + +  GL I+  KT  M      +   +
Sbjct: 142 ETVIRDLLFADDCALNAVNEHDMQQEMDAFSSACDNFGLTISIKKTEVMYQPAPGKPYQE 201

Query: 327 NTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMT 151
               +K Q    +V    Y+ G  LS    +D +I  RI KA  AF +L K VWE   ++
Sbjct: 202 PNITVKGQRLQ-DVENFTYL-GSTLSRNANTDAEINNRIAKASSAFGRLRKSVWERRGIS 259

Query: 150 RRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +  K+ ++ ++V + LL+GCETW + +     LQ F  +CLR+IL I W
Sbjct: 260 QCTKIKVYRAVVLTTLLYGCETWTIYRRHEKLLQQFHLRCLRNILNIRW 308



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P + I I++  + G   RV+ D    AP +++ GVKQGC+L+P LF ++   ++ +
Sbjct: 52  GCPERFIKIVRQFHDGMMARVLDDGNTSAPFQVSNGVKQGCVLAPTLFSLMFSAMLTD 109


>SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34)
          Length = 470

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 54/169 (31%), Positives = 84/169 (49%), Gaps = 7/169 (4%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSK 328
           E ++ DL +ADD  L       MQ +++    + +  GL I+  KT  M      +   +
Sbjct: 269 ETVIRDLLFADDCALNAVNEHDMQQEMDAFSSACDNFGLTISIKKTEVMYQPAPGKPYQE 328

Query: 327 NTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMT 151
               +K Q    +V    Y+ G  LS     D +I  RI KA  AF +L K VWE   ++
Sbjct: 329 PNITVKGQRLQ-DVENFTYL-GSTLSRNANIDAEINNRIAKASSAFGRLRKSVWERRGIS 386

Query: 150 RRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +  K+ ++ ++V + LL+GCETW + +     LQ F  +CLR+IL I W
Sbjct: 387 QCTKIKVYRAVVLTTLLYGCETWTIYRRHEKLLQQFHLRCLRNILNIRW 435



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P + I I++  + G   RV+ D    AP +++ GVKQGC+L+P LF ++   ++ +
Sbjct: 179 GCPERFIKIVRQFHDGMMARVLDDGNTSAPFQVSNGVKQGCVLAPTLFSLMFSAMLTD 236


>SB_32337| Best HMM Match : CaMBD (HMM E-Value=5.9)
          Length = 289

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 54/169 (31%), Positives = 84/169 (49%), Gaps = 7/169 (4%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSK 328
           E ++ DL +ADD  L       MQ +++    + +  GL I+  KT  M      +   +
Sbjct: 74  ETVIRDLLFADDCALNAVNEHDMQQEMDAFSSACDNFGLTISIKKTEVMYQPAPGKPYQE 133

Query: 327 NTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMT 151
               +K Q    +V    Y+ G  LS     D +I  RI KA  AF +L K VWE   ++
Sbjct: 134 PNITVKGQRLQ-DVENFTYL-GSTLSRNANIDAEINNRIAKASSAFGRLRKSVWERRGIS 191

Query: 150 RRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +  K+ ++ ++V + LL+GCETW + +     LQ F  +CLR+IL I W
Sbjct: 192 QCTKIKVYRAVVLTTLLYGCETWTIYRRHEKLLQQFHLRCLRNILNIRW 240



 Score = 37.5 bits (83), Expect = 0.013
 Identities = 15/39 (38%), Positives = 26/39 (66%)
 Frame = -1

Query: 638 RVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           RV+ D    AP +++ GVKQGC+L+P LF ++   ++ +
Sbjct: 3   RVLDDGNTSAPFQVSNGVKQGCVLAPTLFSLMFSAMLTD 41


>SB_19821| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 434

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 54/169 (31%), Positives = 84/169 (49%), Gaps = 7/169 (4%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSK 328
           E ++ DL +ADD  L       MQ +++    + +  GL I+  KT  M      +   +
Sbjct: 204 ETVIRDLLFADDCALNAVNEHDMQQEMDAFSSACDNFGLTISIKKTEVMYQPAPGKPYQE 263

Query: 327 NTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMT 151
               +K Q    +V    Y+ G  LS     D +I  RI KA  AF +L K VWE   ++
Sbjct: 264 PNITVKGQRLQ-DVENFTYL-GSTLSRNANIDAEINNRIAKASSAFGRLRKSVWERRGIS 321

Query: 150 RRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +  K+ ++ ++V + LL+GCETW + +     LQ F  +CLR+IL I W
Sbjct: 322 QCTKIKVYRAVVLTTLLYGCETWTIYRRHEKLLQQFHLRCLRNILNIRW 370



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P + I I++  + G   RV+ D    AP +++ GVKQGC+L+P LF ++   ++ +
Sbjct: 114 GCPERFIKIVRQFHDGMMARVLDDGNTSAPFQVSNGVKQGCVLAPTLFSLMFSAMLTD 171


>SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34)
          Length = 425

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 54/169 (31%), Positives = 84/169 (49%), Gaps = 7/169 (4%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSK 328
           E ++ DL +ADD  L       MQ +++    + +  GL I+  KT  M      +   +
Sbjct: 210 ETVIRDLLFADDCALNAVNEHDMQQEMDAFSSACDNFGLTISIKKTEVMYQPAPGKPYQE 269

Query: 327 NTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMT 151
               +K Q    +V    Y+ G  LS     D +I  RI KA  AF +L K VWE   ++
Sbjct: 270 PNITVKGQRLQ-DVENFTYL-GSTLSRNANIDAEINNRIAKASSAFGRLRKSVWERRGIS 327

Query: 150 RRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +  K+ ++ ++V + LL+GCETW + +     LQ F  +CLR+IL I W
Sbjct: 328 QCTKIKVYRAVVLTTLLYGCETWTIYRRHEKLLQQFHLRCLRNILNIRW 376



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P + I I++  + G   RV+ D    AP +++ GVKQGC+L+P LF ++   ++ +
Sbjct: 120 GCPERFIKIVRQFHDGMMARVLDDGNTSAPFQVSNGVKQGCVLAPTLFSLMFSAMLTD 177


>SB_5327| Best HMM Match : zf-C2H2 (HMM E-Value=0.13)
          Length = 328

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 54/169 (31%), Positives = 84/169 (49%), Gaps = 7/169 (4%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSK 328
           E ++ DL +ADD  L       MQ +++    + +  GL I+  KT  M      +   +
Sbjct: 4   ETVIRDLLFADDCALNAVNEHDMQQEMDAFSSACDNFGLTISIKKTEVMYQPAPGKPYQE 63

Query: 327 NTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMT 151
               +K Q    +V    Y+ G  LS     D +I  RI KA  AF +L K VWE   ++
Sbjct: 64  PNITVKGQRLQ-DVENFTYL-GSTLSRNANIDAEINNRIAKASSAFGRLRKSVWERRGIS 121

Query: 150 RRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +  K+ ++ ++V + LL+GCETW + +     LQ F  +CLR+IL I W
Sbjct: 122 QCTKIKVYRAVVLTTLLYGCETWTIYRRHEKLLQQFHLRCLRNILNIRW 170


>SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42)
          Length = 590

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 48/160 (30%), Positives = 76/160 (47%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+    L + D
Sbjct: 417 IRDLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTLTIND 476

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 477 FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 536

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 537 ACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 576



 Score = 37.5 bits (83), Expect = 0.013
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           G P K++  I++ + G+   V  +       ++  GVKQGC+L+P LF +    ++R
Sbjct: 324 GCPPKLLNFIKSFHDGTHGTVKCESNSSEAFDINIGVKQGCVLAPTLFNIFFSVLLR 380


>SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11)
          Length = 959

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 53/169 (31%), Positives = 83/169 (49%), Gaps = 7/169 (4%)
 Frame = -3

Query: 489  ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSK 328
            E ++ DL +ADD  L       MQ +++    + +  GL I+  KT  M      +   +
Sbjct: 699  ETVIRDLLFADDCALNAVNEHDMQQEMDAFSSACDNFGLTISIKKTEVMYQPXPGKPYQE 758

Query: 327  NTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMT 151
                +K Q    +V    Y+ G  LS     D +I  RI KA  AF +L K VWE   ++
Sbjct: 759  PNITVKGQRLQ-DVENFTYL-GSTLSRNANIDAEINNRIAKASSAFGRLRKSVWERRGIS 816

Query: 150  RRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            +  K+ ++ ++V + LL+G ETW + +     LQ F  +CLR+IL I W
Sbjct: 817  QCTKIKVYRAVVLTTLLYGWETWTIYRRHEKLLQQFHLRCLRNILNIRW 865



 Score = 31.9 bits (69), Expect = 0.66
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQ 579
           G P + I I++  + G   RV+ D    AP +++ GVKQ
Sbjct: 658 GCPERFIKIVRQFHDGMMARVLDDGNTSAPFQVSNGVKQ 696


>SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 629

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 32/62 (51%), Positives = 45/62 (72%)
 Frame = -3

Query: 186 QLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIF 7
           QLK +W SS ++   K+ LF++IVK +L++G ETWR T T   ++QVF+N CLR IL+I 
Sbjct: 535 QLKNIWGSSEISITTKIRLFNTIVKPILVYGAETWRTTVTTIKKIQVFINTCLRKILKIR 594

Query: 6   WP 1
           WP
Sbjct: 595 WP 596


>SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42)
          Length = 416

 Score = 75.4 bits (177), Expect = 5e-14
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+      + D
Sbjct: 95  IRDLLFADDAALVAQSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTIND 154

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 155 FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 214

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 215 ACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 254



 Score = 37.9 bits (84), Expect = 0.010
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           G P K++  I++ + G+   V  +       ++  GVKQGC+L+P LF +    ++R
Sbjct: 2   GCPPKLLNFIKSFHDGTRGTVKCESNSSEAFDINIGVKQGCVLAPTLFNIFFSVLLR 58


>SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 370

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+      + D
Sbjct: 69  IRDLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTIND 128

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 129 FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 188

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 189 ACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 228


>SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58)
          Length = 404

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 48/160 (30%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 123 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 180

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LSN      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 181 IKLVNVTHFKYLGSILSNDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 240

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 241 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 280



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 24  LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 75


>SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 798

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+      + D
Sbjct: 455 IRDLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTIND 514

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 515 FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 574

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 575 ACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 614


>SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 950

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+      + D
Sbjct: 499 IRDLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTIND 558

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 559 FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 618

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G E+W        RL  F  +CLR I RI W
Sbjct: 619 ACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRIPRIHW 658



 Score = 37.9 bits (84), Expect = 0.010
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           G P K++  I++ + G+   V  +       ++  GVKQGC+L+P LF +    ++R
Sbjct: 406 GCPPKLLNFIKSFHDGTRGTVKCESNSSEAFDINIGVKQGCVLAPTLFNIFFSVLLR 462


>SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 290

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+      + D
Sbjct: 38  IRDLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTIND 97

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 98  FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 157

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 158 ACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 197


>SB_29550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 464

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 43/167 (25%), Positives = 90/167 (53%), Gaps = 7/167 (4%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
           I+ ++ YADD  L+   ++ MQ  ++ L  +AE+  L+IN  KT      V  + +++  
Sbjct: 231 IVREMLYADDSALVAHDVESMQRLVDRLSSAAEQFSLKINIKKTECLFQPVKRQTLTQFP 290

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
             + +++     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ +
Sbjct: 291 GEIHVRNETLVQNKDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLK 350

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +K  ++ ++V S L++G ETW V ++    L  ++ + LR I++I W
Sbjct: 351 VKGKVYRAVVLSALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITW 397



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           G P K + +I++L+ G    V          +++ GVKQGC+L+P LF + L  ++
Sbjct: 139 GCPPKFVNVIRSLHSGMKASVSQGGNDSKQFDVSNGVKQGCVLAPTLFSLYLSAML 194


>SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 348

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+      + D
Sbjct: 38  IRDLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTIND 97

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 98  FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 157

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 158 ACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 197


>SB_6390| Best HMM Match : BCL_N (HMM E-Value=8.4)
          Length = 194

 Score = 74.5 bits (175), Expect = 9e-14
 Identities = 51/161 (31%), Positives = 79/161 (49%), Gaps = 7/161 (4%)
 Frame = -3

Query: 465 YADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSKNTTPLKLQ 304
           +ADD  L       MQ +++    + +  GL I+  KT  M      +   +    +K Q
Sbjct: 28  FADDCALNAVNEHDMQQEMDAFSSACDNFGLTISIKKTEVMYQPAPGKPYQEPNITVKGQ 87

Query: 303 DCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLF 127
               +V    Y+ G  LS     D +I  RI KA  AF +L K VWE   +++  K+ ++
Sbjct: 88  RLQ-DVENFTYL-GSTLSRNANIDAEINNRIAKASSAFGRLRKSVWERRGISQCTKIKVY 145

Query: 126 DSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            ++V + LL+GCETW + +     LQ F  +CLR+IL I W
Sbjct: 146 RAVVLTTLLYGCETWTIYRRHEKLLQQFHLRCLRNILNIRW 186


>SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43)
          Length = 458

 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 47/160 (29%), Positives = 74/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L     +     L I+  KT  M + S+      + D
Sbjct: 206 IRDLLFADDAALVAHSESELQSLLHRFSNACADFSLAISLKKTKVMHLGSEIAPTFTIND 265

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 266 FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 325

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 326 ACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 365



 Score = 37.9 bits (84), Expect = 0.010
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           G P K++  I++ + G+   V  +       ++  GVKQGC+L+P LF +    ++R
Sbjct: 113 GCPPKLLNFIKSFHDGTRGTVKCESNSSEAFDINIGVKQGCVLAPTLFNIFFSVLLR 169


>SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2973

 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480  LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
            + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+    + + D
Sbjct: 2297 IRDLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTVTIND 2356

Query: 300  CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
               +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 2357 FTLDVVPQFTYLGSTTSANGCLDIELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 2416

Query: 123  SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            + + S LL+G E W        RL  F  +CLR IL I W
Sbjct: 2417 ACILSTLLYGSEPWTTYARQEKRLNTFHMRCLRRILGIHW 2456



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = -1

Query: 695  GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
            G P K++  I++ + G+   V  +       ++  GVKQGC+L+P LF +    ++R
Sbjct: 2204 GCPPKLLNFIKSFHEGTCGTVKCESNSSEAFDINTGVKQGCVLAPTLFNIFFSVLLR 2260


>SB_28333| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 389

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 42/167 (25%), Positives = 89/167 (53%), Gaps = 7/167 (4%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
           I+ ++ YADD  L+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++  
Sbjct: 39  IVREMLYADDSALVAHDVESMQRLVDRFSTAAEQFSLKINIKKTECLFQPVKRQTLTQFP 98

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
             + +++     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ +
Sbjct: 99  GEIHVRNETLVQTKDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLK 158

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +K  ++ ++V S L++G ETW V ++    L  ++ + LR I++I W
Sbjct: 159 VKGKVYRAVVLSALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITW 205


>SB_24941| Best HMM Match : DPRP (HMM E-Value=1)
          Length = 354

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 42/167 (25%), Positives = 89/167 (53%), Gaps = 7/167 (4%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
           I+ ++ YADD  L+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++  
Sbjct: 39  IVREMLYADDSALVAHDVESMQRLVDRFSTAAEQFSLKINIKKTECLFQPVKRQTLTQFP 98

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
             + +++     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ +
Sbjct: 99  GEIHVRNETLVQTKDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLK 158

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +K  ++ ++V S L++G ETW V ++    L  ++ + LR I++I W
Sbjct: 159 VKGKVYRAVVLSALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITW 205


>SB_46702| Best HMM Match : LETM1 (HMM E-Value=5.5)
          Length = 306

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 42/167 (25%), Positives = 89/167 (53%), Gaps = 7/167 (4%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
           I+ ++ YADD  L+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++  
Sbjct: 39  IVREMLYADDSALVAHDVESMQRLVDRFSSAAEQFSLKINIKKTECLFQPVKRQTLTQFP 98

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
             + +++     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ +
Sbjct: 99  GEIHVRNKTLVQTKDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLK 158

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +K  ++ ++V S L++G ETW V ++    L  ++ + LR I++I W
Sbjct: 159 VKGKVYRAVVLSALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITW 205


>SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43)
          Length = 677

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +L +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+      + D
Sbjct: 377 IRNLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTIND 436

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 437 FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 496

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + V S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 497 ACVLSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 536



 Score = 37.9 bits (84), Expect = 0.010
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           G P K++  I++ + G+   V  +       ++  GVKQGC+L+P LF +    ++R
Sbjct: 284 GCPPKLLNFIKSFHDGTRGTVKCESNSSEAFDINIGVKQGCVLAPTLFNIFFSVLLR 340


>SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30)
          Length = 841

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 47/160 (29%), Positives = 80/160 (50%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480  LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
            + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 560  IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 617

Query: 300  CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                  T     G +LS+      ++  RI+    A+++L K V++S  +T   K+ +++
Sbjct: 618  IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYSRLRKRVFDSRDLTVPTKIAVYN 677

Query: 123  SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
              +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 678  QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 717



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 461 LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 512


>SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035)
          Length = 322

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 46/160 (28%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  +T  M + S+      + D
Sbjct: 135 IRDLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKETKVMHLGSEIAPTFTIND 194

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 195 FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 254

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 255 ACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 294



 Score = 37.5 bits (83), Expect = 0.013
 Identities = 16/57 (28%), Positives = 31/57 (54%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           G P K++  I++ + G+   V  +       ++  G+KQGC+L+P LF +    ++R
Sbjct: 42  GCPPKLLNFIKSFHDGTRGTVKCESNSSEAFDINIGIKQGCVLAPTLFNIFFSVLLR 98


>SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 342

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 46/160 (28%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+      + D
Sbjct: 21  IRDLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTIND 80

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 81  FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 140

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G ++W        RL  F  +CLR IL I W
Sbjct: 141 ACILSTLLYGSKSWTTYARQEKRLNTFHMRCLRRILGIHW 180


>SB_18732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13)
          Length = 1582

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 42/167 (25%), Positives = 89/167 (53%), Gaps = 7/167 (4%)
 Frame = -3

Query: 483  ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
            I+ ++ YADD  L+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++  
Sbjct: 1349 IVREMLYADDSALVAHDVESMQRLVDRFSSAAEQFSLKINIKKTECLFQPVKRQTLTQFP 1408

Query: 321  TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
              + +++     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ +
Sbjct: 1409 GEIHVRNETLVQTKDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLK 1468

Query: 144  IKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            +K  ++ ++V S L++G ETW V ++    L  ++ + LR I++I W
Sbjct: 1469 VKGKVYRAVVLSALVYGAETWTVYRSQVKNLHAYMMRHLREIMKITW 1515



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = -1

Query: 695  GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            G P K + +I++L+ G    V          +++ GVKQGC+L+P LF + L  ++
Sbjct: 1257 GCPPKFVNVIRSLHSGMKASVSQGGNDSKQFDVSNGVKQGCVLAPTLFSLYLSAML 1312


>SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 559

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 349 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 406

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 407 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 466

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 467 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 506



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 22/52 (42%), Positives = 27/52 (51%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+  LF
Sbjct: 250 LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLALTLF 301


>SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43)
          Length = 1074

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480  LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
            + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 793  IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 850

Query: 300  CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                  T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 851  IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 910

Query: 123  SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
              +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 911  QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 950



 Score = 29.9 bits (64), Expect = 2.7
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = -1

Query: 650 GSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           G   +++ D  L    E   GVKQGC L+P LF
Sbjct: 713 GCPPKLIVDGELTRAFEYNCGVKQGCKLAPTLF 745


>SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06)
          Length = 744

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 463 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 520

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 521 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 580

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 581 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 620


>SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 387

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 106 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 163

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 164 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 223

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 224 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 263


>SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 397

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 154 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTRKTETMCI--GNTADFYVDG 211

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 212 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 271

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 272 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 311


>SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06)
          Length = 530

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+    L + D
Sbjct: 209 IRDLLFADDAALVAHSESELQSLLDCFSNACADFSLAISLKKTKVMHLGSEIAPTLTIND 268

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 269 FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 328

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G E+W        RL  F  +CL  IL I W
Sbjct: 329 ACILSTLLYGSESWTTYARQEKRLNTFHMRCLCRILGIHW 368



 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/55 (29%), Positives = 30/55 (54%)
 Frame = -1

Query: 689 PNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           P K++  I++ + G+   V  +       ++  GVKQGC+L+P LF +    ++R
Sbjct: 118 PPKLLNFIKSFHDGTRGTVKCESNSSEAFDINIGVKQGCVLAPTLFNIFFSVLLR 172


>SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 912

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480  LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
            + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 633  IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 690

Query: 300  CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                  T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 691  IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 750

Query: 123  SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
              +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 751  QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 790



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 534 LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 585


>SB_12170| Best HMM Match : RVT_1 (HMM E-Value=0.58)
          Length = 294

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 123 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 180

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 181 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 240

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 241 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 280



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 24  LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 75


>SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 410

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+    L + D
Sbjct: 89  IRDLLFADDAALVAHSESELQSLLDCFSNACADFSLAISLKKTKVMHLGSEIAPTLTIND 148

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
              +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 149 FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 208

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + + S LL+G E+W        RL  F  +CL  IL I W
Sbjct: 209 ACILSTLLYGSESWTTYARQEKRLNTFHMRCLCRILGIHW 248



 Score = 31.9 bits (69), Expect = 0.66
 Identities = 14/52 (26%), Positives = 28/52 (53%)
 Frame = -1

Query: 680 IIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           ++  I++ + G+   V  +       ++  GVKQGC+L+P LF +    ++R
Sbjct: 1   LLNFIKSFHDGTRGTVKCESNSSEAFDINIGVKQGCVLAPTLFNIFFSVLLR 52


>SB_42325| Best HMM Match : RVT_1 (HMM E-Value=0.52)
          Length = 333

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 123 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 180

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 181 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 240

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 241 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 280



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 24  LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 75


>SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58)
          Length = 359

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 123 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 180

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 181 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 240

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 241 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 280



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 24  LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 75


>SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 280

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 13  IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 70

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 71  IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 130

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 131 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 170


>SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 358

 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 13  IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 70

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 71  IMLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 130

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 131 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 170


>SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2)
          Length = 294

 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 13  IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 70

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 71  IMLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 130

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 131 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 170


>SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 235

 Score = 72.1 bits (169), Expect = 5e-13
 Identities = 47/158 (29%), Positives = 78/158 (49%), Gaps = 1/158 (0%)
 Frame = -3

Query: 474 DLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCG 295
           +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +    
Sbjct: 2   EAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDGIK 59

Query: 294 FEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSI 118
               T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++  
Sbjct: 60  LVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQC 119

Query: 117 VKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 120 LMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 157


>SB_56583| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6)
          Length = 234

 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 41/161 (25%), Positives = 85/161 (52%), Gaps = 7/161 (4%)
 Frame = -3

Query: 465 YADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNTTPLKLQ 304
           YADD  L+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++    + ++
Sbjct: 3   YADDSALVAHDVESMQRLVDRFSSAAEQFSLKINIKKTECLFQPVKRQTLTQFPGEIHVR 62

Query: 303 DCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLF 127
           +     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ ++K  ++
Sbjct: 63  NETLVQTKDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLKVKGKVY 122

Query: 126 DSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            ++V S L++G ETW V ++    L  ++ + LR I++I W
Sbjct: 123 RAVVLSALVYGAETWTVYRSQVKTLHAYMMRHLREIMKITW 163


>SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065)
          Length = 435

 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 47/162 (29%), Positives = 83/162 (51%), Gaps = 3/162 (1%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 154 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVD- 210

Query: 300 CGFEVSTEVYIS--GELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTL 130
            G ++   ++    G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +
Sbjct: 211 -GIKLVNVIHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAV 269

Query: 129 FDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           ++  +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 270 YNQCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 311



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 55  LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 106


>SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4)
          Length = 288

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 46/160 (28%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT  + +  
Sbjct: 13  IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADVYVDG 70

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++   I+    A+ +L K V++S  +T   K+ +++
Sbjct: 71  IKLVNVTHFKYLGSILSSDCSMRAELTSLIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 130

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 131 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 170


>SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6)
          Length = 294

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 46/160 (28%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 13  IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 70

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++   I+    A+ +L K V++S  +T   K+ +++
Sbjct: 71  IKLVNVTHFKYLGSILSSDCSMRAELTSLIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 130

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 131 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 170


>SB_10362| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 356

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 48/168 (28%), Positives = 78/168 (46%), Gaps = 5/168 (2%)
 Frame = -3

Query: 492 SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN---T 322
           S + + DL +ADD  L   +L  +Q  ++    +    GL+INT KT  M   +     T
Sbjct: 36  SADTVNDLLFADDCALNATSLADLQHSVDLFSSACNNFGLKINTKKTEAMHQPAPGKLYT 95

Query: 321 TP-LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
            P + +         +    G  LS     D+++  R+ +A  AF +L K VW+   +  
Sbjct: 96  EPNIIINGQKLNAVDKFTYLGSTLSRNVVLDDEVTNRLARASAAFGRLRKNVWKRRGIRT 155

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             K+ ++ ++V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 156 DTKIKVYRAVVLPTLLYGSETWTIYKHHAMKLNHFHTTCLRKILDVRW 203


>SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6)
          Length = 294

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 46/160 (28%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 13  IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 70

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++   I+    A+ +L K V++S  +T   K+ +++
Sbjct: 71  IKLVNVTHFKYLGSILSSDCSMRAELTSLIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 130

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 131 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 170


>SB_41510| Best HMM Match : Minor_tail_Z (HMM E-Value=3.5)
          Length = 208

 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)
 Frame = -3

Query: 291 EVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIV 115
           +V    Y+ G  LS     D +I  RI KA  AF +L K VWE   +++  K+ ++ ++V
Sbjct: 24  DVENFTYL-GSTLSRNANIDAEINNRIAKASSAFGRLRKSVWERRGISQCTKIKVYRAVV 82

Query: 114 KSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            + LL+GCETW + +     LQ F  +CLR+IL I W
Sbjct: 83  LTTLLYGCETWTIYRRHEKLLQQFHLRCLRNILNIRW 119


>SB_40055| Best HMM Match : zf-C2H2 (HMM E-Value=0.13)
          Length = 303

 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)
 Frame = -3

Query: 291 EVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIV 115
           +V    Y+ G  LS     D +I  RI KA  AF +L K VWE   +++  K+ ++ ++V
Sbjct: 50  DVENFTYL-GSTLSRNANIDAEINNRIAKASSAFGRLRKSVWERRGISQCTKIKVYRAVV 108

Query: 114 KSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            + LL+GCETW + +     LQ F  +CLR+IL I W
Sbjct: 109 LTTLLYGCETWTIYRRHEKLLQQFHLRCLRNILNIRW 145


>SB_32967| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 374

 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 51/164 (31%), Positives = 75/164 (45%), Gaps = 5/164 (3%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK--- 310
           L  L +ADD  L   T  +MQ  +     +    GL I+T KT  M   + NT  ++   
Sbjct: 104 LRVLLFADDCALNANTGLEMQESVNKFSDACNNFGLTISTKKTEVMLQPAPNTPYMEPEI 163

Query: 309 -LQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKL 136
            +         +    G  LS     D+++  RI KA  +F +L K VW    ++   KL
Sbjct: 164 YINSQRLNPVEKFTYLGSTLSRVIHIDDEVNARIAKASASFGRLSKTVWNRRGISTETKL 223

Query: 135 TLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            ++ +IV + LL+ CETW V +    +L  F   CLR IL I W
Sbjct: 224 GVYRAIVLTSLLYACETWTVYQRHARKLNHFHTICLRKILGIKW 267


>SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23)
          Length = 855

 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 50/169 (29%), Positives = 81/169 (47%), Gaps = 6/169 (3%)
 Frame = -3

Query: 492  SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMR--VMSKNTT 319
            S + + DL +ADD  L   +   +Q  ++    +    GL+INT KT  M      K  T
Sbjct: 535  SADTVNDLLFADDCALNATSQADLQHSVDLFSSACNNFGLKINTKKTEAMHQPAPGKPYT 594

Query: 318  PLKLQDCGFEVSTE---VYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMT 151
               +   G +++     +Y+ G  LS     D+++  R+  A  AF +L K VW+   + 
Sbjct: 595  EPNIIINGQKLNAVDKFIYL-GSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIR 653

Query: 150  RRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
               K+ ++ ++V S LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 654  TDTKIKVYRAVVLSTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 702



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 18/58 (31%), Positives = 32/58 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P+K I I++ L+ G    V  +        ++ GVKQGC+L+P LF ++   ++ +
Sbjct: 446 GCPSKFINIVRQLHDGMLASVQDNGETSHSFPVSNGVKQGCVLAPTLFSLMFSAMLTD 503


>SB_9519| Best HMM Match : zf-C2H2 (HMM E-Value=0.13)
          Length = 299

 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)
 Frame = -3

Query: 291 EVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIV 115
           +V    Y+ G  LS     D +I  RI KA  AF +L K VWE   +++  K+ ++ ++V
Sbjct: 46  DVENFTYL-GSTLSRNANIDAEINNRIAKASSAFGRLRKSVWERRGISQCTKIKVYRAVV 104

Query: 114 KSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            + LL+GCETW + +     LQ F  +CLR+IL I W
Sbjct: 105 LTTLLYGCETWTIYRRHEKLLQQFHLRCLRNILNIRW 141


>SB_57364| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 318

 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 51/164 (31%), Positives = 75/164 (45%), Gaps = 5/164 (3%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK--- 310
           L  L +ADD  L   T  +MQ  +     +    GL I+T KT  M   + NT  ++   
Sbjct: 11  LRVLLFADDCALNANTGLEMQESVNKFSDACNNFGLTISTKKTEVMLQPAPNTPYMEPEI 70

Query: 309 -LQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKL 136
            +         +    G  LS     D+++  RI KA  +F +L K VW    ++   KL
Sbjct: 71  YINSQRLNPVEKFTYLGSTLSRVIHIDDEVNARIAKASASFGRLSKTVWNRRGISTETKL 130

Query: 135 TLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            ++ +IV + LL+ CETW V +    +L  F   CLR IL I W
Sbjct: 131 GVYRAIVLTSLLYACETWTVYQRHARKLNHFHTICLRKILGIKW 174


>SB_44220| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 310

 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 46/158 (29%), Positives = 78/158 (49%), Gaps = 1/158 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 154 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 211

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 212 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 271

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRI 10
             +  +LL+G ETW V +     L+    + LR IL+I
Sbjct: 272 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKI 309



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 55  LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 106


>SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37)
          Length = 565

 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 51/164 (31%), Positives = 75/164 (45%), Gaps = 5/164 (3%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK--- 310
           L  L +ADD  L   T  +MQ  +     +    GL I+T KT  M   + NT  ++   
Sbjct: 250 LRVLLFADDCALNANTGLEMQESVNKFSDACNNFGLTISTKKTEVMLQPAPNTPYMEPEI 309

Query: 309 -LQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKL 136
            +         +    G  LS     D+++  RI KA  +F +L K VW    ++   KL
Sbjct: 310 YINSQRLNPVEKFTYLGSTLSRVIHIDDEVNARIAKASASFGRLSKTVWNRRGISTETKL 369

Query: 135 TLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            ++ +IV + LL+ CETW V +    +L  F   CLR IL I W
Sbjct: 370 GVYRAIVLTSLLYACETWTVYQRHARKLNHFHTICLRKILGIKW 413



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 19/58 (32%), Positives = 33/58 (56%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P +   +++  + G    V+ D    AP ++T GVKQGC+L+P LF M+   ++ +
Sbjct: 157 GCPPRFTSMVRQFHDGMQAHVLEDGNQSAPFQVTNGVKQGCVLAPTLFSMMFTAMLAD 214



 Score = 29.9 bits (64), Expect = 2.7
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = -3

Query: 804 KCRIGRLKMILTFVDF*EKRFDTVQWSKMWTLL 706
           KC+     +  TFVD   K FDTV  S +WT++
Sbjct: 122 KCQEQHTALFTTFVDL-TKAFDTVSRSGLWTIM 153


>SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 591

 Score = 69.3 bits (162), Expect = 4e-12
 Identities = 46/160 (28%), Positives = 77/160 (48%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   N     +  
Sbjct: 272 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNNADFYVDG 329

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 330 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 389

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L     + LR IL+I W
Sbjct: 390 QCLMPLLLYGSETWTVYQHEVRELCTLQQRHLRLILKIKW 429



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 22/52 (42%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I +I+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 173 LGKLGCPPKFISVIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 224


>SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3669

 Score = 69.3 bits (162), Expect = 4e-12
 Identities = 49/168 (29%), Positives = 90/168 (53%), Gaps = 6/168 (3%)
 Frame = -3

Query: 489  ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK 310
            E ++ D  +ADD  LM    + +Q  ++    +++  GL+I+ +KT  +   + ++ P +
Sbjct: 3079 ERLILDALFADDCALMAHQENHLQTIVDKFSEASKLFGLKISLSKTEVLLQPAPDSIPQQ 3138

Query: 309  --LQDCGFE---VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTR 148
              +   G +   V + VY+ G  +SN    D++I  RI+KA  A  +L+  V +   +  
Sbjct: 3139 PCITIDGTQLKNVDSFVYL-GSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRL 3197

Query: 147  RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
              KL ++++IV   LL+GCETW +      +L+ F  + LR+I+RI W
Sbjct: 3198 STKLKVYNAIVLPSLLYGCETWTLYCRHIKKLERFHTRSLRAIMRIRW 3245



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 20/67 (29%), Positives = 33/67 (49%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            L + G P K   +I+  +   T  V+ D        ++ GVKQGC+L+P+LF +    ++
Sbjct: 2985 LSKLGCPAKFTTLIRLFHDDMTGEVLSDGEPSESFSISNGVKQGCVLAPVLFNLFFTQVL 3044

Query: 527  REVVTTL 507
               V  L
Sbjct: 3045 LHAVRDL 3051


>SB_4898| Best HMM Match : CaMBD (HMM E-Value=1.2)
          Length = 259

 Score = 68.9 bits (161), Expect = 5e-12
 Identities = 49/175 (28%), Positives = 92/175 (52%), Gaps = 6/175 (3%)
 Frame = -3

Query: 510 TRGIEWSENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMS 331
           T   +  E ++ D  +ADD  LM    + +Q  ++    +++  GL+I+ +KT  +   +
Sbjct: 23  TANTKTMERLILDALFADDCALMAHQENHLQTIVDKFSEASKLFGLKISLSKTEVLLQPA 82

Query: 330 KNTTPLK--LQDCGFE---VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VW 169
            ++ P +  +   G +   V + VY+ G  +SN    D++I  RI+KA  A  +L+  V 
Sbjct: 83  PDSIPQQPCITIDGTQLKNVDSFVYL-GSTISNDNTLDKEIAARIQKASHALGKLRTKVL 141

Query: 168 ESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +   +    KL +++++V   LL+GCETW +      +L+ F  + LR+I+RI W
Sbjct: 142 QHQDIHLSTKLKVYNAVVLPSLLYGCETWTLYCRHIKKLERFHTRSLRAIMRIRW 196


>SB_28415| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)
          Length = 356

 Score = 68.9 bits (161), Expect = 5e-12
 Identities = 47/168 (27%), Positives = 77/168 (45%), Gaps = 5/168 (2%)
 Frame = -3

Query: 492 SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN---T 322
           S + + DL +ADD  L   +   +Q  ++    +    GL+INT KT  M   +     T
Sbjct: 36  SADTVNDLLFADDCALNATSQADLQHSVDLFSSACNNFGLKINTKKTEAMHQPAPGKPYT 95

Query: 321 TP-LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
            P + +         +    G  LS     D+++  R+ +A  AF +L K VW+   +  
Sbjct: 96  EPNIIINGQKLNAVDKFTYLGSTLSRNVVLDDEVTNRLARASAAFGRLRKNVWKRRGIRT 155

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             K+ ++ ++V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 156 DTKIKVYRAVVLPTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 203


>SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42)
          Length = 717

 Score = 68.9 bits (161), Expect = 5e-12
 Identities = 45/156 (28%), Positives = 72/156 (46%), Gaps = 1/156 (0%)
 Frame = -3

Query: 480  LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
            + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+      + D
Sbjct: 561  IRDLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTIND 620

Query: 300  CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFD 124
               +V  +    G   S  G  D ++  RI KA     +L   VWE+  +T   K+T++ 
Sbjct: 621  FTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYR 680

Query: 123  SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSIL 16
            +   S LL+G E+W        RL  F  +CLR IL
Sbjct: 681  ACTLSTLLYGSESWTTYARQEKRLNTFHMRCLRRIL 716



 Score = 36.7 bits (81), Expect = 0.023
 Identities = 17/57 (29%), Positives = 30/57 (52%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           G P K++  I++ + G    V  +       ++  GVKQGC+L+P LF +    ++R
Sbjct: 468 GCPPKLLNFIKSFHDGIRGTVKCESNSSEAFDINIGVKQGCVLAPTLFNIFFSVLLR 524


>SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6)
          Length = 294

 Score = 68.5 bits (160), Expect = 6e-12
 Identities = 45/160 (28%), Positives = 77/160 (48%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 13  IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 70

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++   I+    A+ +L K V++S  +T   K+ +++
Sbjct: 71  IKLVNVTHFKYLGSILSSDCSMRAELTSLIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 130

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +      +    + LR IL+I W
Sbjct: 131 QCLMPLLLYGSETWTVYQHEVREFRTLQQRHLRLILKIKW 170


>SB_17856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 185

 Score = 68.5 bits (160), Expect = 6e-12
 Identities = 31/61 (50%), Positives = 41/61 (67%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  G+P KI  II+  Y G TCRVVH + L    E+  GV+QGCLLSP LF++ +D IM
Sbjct: 116 LRHYGVPEKITNIIRKSYEGMTCRVVHGRQLIDAFEIRTGVRQGCLLSPFLFLLAIDWIM 175

Query: 527 R 525
           +
Sbjct: 176 K 176


>SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 801

 Score = 68.5 bits (160), Expect = 6e-12
 Identities = 48/168 (28%), Positives = 89/168 (52%), Gaps = 6/168 (3%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK 310
           E ++ D  +ADD  LM    + +Q  ++    +++  GL I+ +KT  +   + ++ P +
Sbjct: 481 ERLILDALFADDCALMAHQENHLQTIVDKFSEASKLFGLTISLSKTEVLLQPAPDSIPQQ 540

Query: 309 --LQDCGFE---VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTR 148
             +   G +   V + VY+ G  +SN    D++I  RI+KA  A  +L+  V +   +  
Sbjct: 541 PCITIDGTQLKNVDSFVYL-GSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRL 599

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             KL ++++IV   LL+GCETW + +    +L+ F  + LR+I+ I W
Sbjct: 600 STKLKVYNAIVLPSLLYGCETWTLYRRHIKKLEQFHTRSLRAIMHIRW 647



 Score = 37.5 bits (83), Expect = 0.013
 Identities = 19/64 (29%), Positives = 32/64 (50%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L + G P K   +I+  +   T  V+ D        ++ GVKQGC+L+P+LF +    ++
Sbjct: 412 LSKLGCPAKFTTLIRLSHDDMTGEVLSDGKPSESFSISNGVKQGCVLAPVLFNLFFTQVL 471

Query: 527 REVV 516
              V
Sbjct: 472 LPAV 475


>SB_50765| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 381

 Score = 68.1 bits (159), Expect = 8e-12
 Identities = 45/167 (26%), Positives = 75/167 (44%), Gaps = 4/167 (2%)
 Frame = -3

Query: 492 SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN---T 322
           S + + DL +ADD  L       M+  +     +    GL I+T KT  M   +      
Sbjct: 90  STDTINDLLFADDCALNPVPEADMRHSINLFSDACFNFGLTISTKKTEVMHQPAPGKLYV 149

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRR 145
            P  + +   +   +    G  LS     D+++  R+ K   AF +L K VW    +T R
Sbjct: 150 EPTTINEQRLKSVDKFNYLGSTLSRNVVIDDEVNARLAKGSAAFGRLYKNVWNRRGITTR 209

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            K+ ++ ++  + LL+GCE+W V +  + +L  F   CLR +  I W
Sbjct: 210 TKIKVYRAVALTALLYGCESWTVYQRHSRKLNHFHTTCLRKLRGITW 256



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 14/47 (29%), Positives = 27/47 (57%)
 Frame = -1

Query: 611 APIEMTAGVKQGCLLSPLLFIMLLDDIMREVVTTLGALNGAKISWKT 471
           AP  +++GV+QGC+L+P  F ++   ++       G   G  I+++T
Sbjct: 29  APSPVSSGVEQGCVLAPTFFSLVFSAMLTNAFRDAGV--GIGINYRT 73


>SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36)
          Length = 1195

 Score = 68.1 bits (159), Expect = 8e-12
 Identities = 49/168 (29%), Positives = 89/168 (52%), Gaps = 6/168 (3%)
 Frame = -3

Query: 489  ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK 310
            E ++ D  +ADD  LM    + +Q  ++    +++  GL I+ +KT  +   + ++ P +
Sbjct: 849  ERLILDALFADDCALMAHQENHLQTIVDKFSEASKLFGLTISLSKTEVLLQPAPDSIPQQ 908

Query: 309  --LQDCGFE---VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTR 148
              +   G +   V + VY+ G  +SN    D++I  RI+KA  A  +L+  V +   +  
Sbjct: 909  PCITIDGTQLKNVDSFVYL-GSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRL 967

Query: 147  RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
              KL ++++IV   LL+GCETW +      +L+ F  + LR+I+RI W
Sbjct: 968  STKLKVYNAIVLPSLLYGCETWTLYCRHIKKLERFHTRSLRAIMRIRW 1015



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 20/67 (29%), Positives = 33/67 (49%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L + G P K   +I+  +   T  V+ D        ++ GVKQGC+L+P+LF +    ++
Sbjct: 755 LSKLGCPAKFTTLIRLFHDDMTGEVLSDGEPSESFSISNGVKQGCVLAPVLFNLFFTQVL 814

Query: 527 REVVTTL 507
              V  L
Sbjct: 815 LHAVRDL 821


>SB_52360| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)
          Length = 455

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 47/168 (27%), Positives = 77/168 (45%), Gaps = 5/168 (2%)
 Frame = -3

Query: 492 SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN---T 322
           S + + DL +ADD  L   +   +Q  ++    + +  GL+INT KT  M   +     T
Sbjct: 135 SADTINDLLFADDCALNATSQADLQHSVDLFSSACKNFGLKINTKKTEAMHQPAPGKPYT 194

Query: 321 TP-LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
            P + +         +    G  LS     D+++  R+  A  AF +L K VW+   +  
Sbjct: 195 EPNIIINGQKLNAVDKFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRT 254

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             K+ ++ ++V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 255 DTKIKVYRAVVLPTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 302



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P+K I I++ L+ G    V  +        ++ GVKQGC+L+P LF +L   ++ +
Sbjct: 46  GCPSKFINIVRQLHDGMLASVQDNGETSHSFPVSNGVKQGCVLAPTLFSLLFSAMLTD 103


>SB_42604| Best HMM Match : DUF1196 (HMM E-Value=5)
          Length = 294

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 47/168 (27%), Positives = 77/168 (45%), Gaps = 5/168 (2%)
 Frame = -3

Query: 492 SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN---T 322
           S + + DL +ADD  L   +   +Q  ++    + +  GL+INT KT  M   +     T
Sbjct: 36  SADTINDLLFADDCALNATSQADLQHSVDLFSSACKNFGLKINTKKTEAMHQPAPGKPYT 95

Query: 321 TP-LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
            P + +         +    G  LS     D+++  R+  A  AF +L K VW+   +  
Sbjct: 96  EPNIIINGQKLNAVDKFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRT 155

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             K+ ++ ++V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 156 DTKIKVYRAVVLPTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 203


>SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36)
          Length = 1092

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 47/168 (27%), Positives = 77/168 (45%), Gaps = 5/168 (2%)
 Frame = -3

Query: 492  SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN---T 322
            S + + DL +ADD  L   +   +Q  ++    + +  GL+INT KT  M   +     T
Sbjct: 772  SADTINDLLFADDCALNATSQADLQHSVDLFSSACKNFGLKINTKKTEAMHQPAPGKPYT 831

Query: 321  TP-LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
             P + +         +    G  LS     D+++  R+  A  AF +L K VW+   +  
Sbjct: 832  EPNIIINGQKLNAVDKFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRT 891

Query: 147  RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
              K+ ++ ++V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 892  DTKIKVYRAVVLPTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 939



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P+K I I++ L+ G    V  +        ++ GVKQGC+L+P LF +L   ++ +
Sbjct: 683 GCPSKFINIVRQLHDGMLASVQDNGETSHSFPVSNGVKQGCVLAPTLFSLLFSAMLTD 740


>SB_58492| Best HMM Match : DUF1196 (HMM E-Value=5)
          Length = 283

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 48/168 (28%), Positives = 78/168 (46%), Gaps = 5/168 (2%)
 Frame = -3

Query: 492 SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMR--VMSKNTT 319
           S + + DL +ADD  L   +   +Q  ++    +    GL+INT KT  M      K  T
Sbjct: 35  SADTVNDLLFADDCALNATSQADLQHSVDLFSSACNNFGLKINTKKTEAMHQPAPGKPYT 94

Query: 318 PLKLQDCGFEVST--EVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
              +   G +++   +    G  LS     D+++  R+  A  AF +L K VW+   +  
Sbjct: 95  ESNIIINGQKLNAVDKFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRT 154

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             K+ ++ ++V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 155 DTKIKVYRAVVLPTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 202


>SB_24913| Best HMM Match : RVT_1 (HMM E-Value=1e-20)
          Length = 906

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 50/164 (30%), Positives = 74/164 (45%), Gaps = 5/164 (3%)
 Frame = -3

Query: 480  LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK--- 310
            L  L +ADD  L      +MQ  +     +    GL I+T KT  M   + NT  ++   
Sbjct: 555  LRVLLFADDCALNANKGLEMQESVNKFSDACNNFGLTISTKKTEVMLQPAPNTPYMEPEI 614

Query: 309  -LQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKL 136
             +         +    G  LS     D+++  RI KA  +F +L K VW    ++   KL
Sbjct: 615  YINSQRLNPVEKFTYLGSTLSRVIHIDDEVNARIAKASASFGRLSKTVWNRRGISTETKL 674

Query: 135  TLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             ++ +IV + LL+ CETW V +    +L  F   CLR IL I W
Sbjct: 675  GVYRAIVLTSLLYACETWTVYQRHARKLNHFHTICLRKILGIKW 718



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 19/58 (32%), Positives = 33/58 (56%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P +   +++  + G    V+ D    AP ++T GVKQGC+L+P LF M+   ++ +
Sbjct: 462 GCPPRFTSMVRQFHDGMQAHVLEDGNQSAPFQVTNGVKQGCVLAPTLFSMMFTAMLAD 519



 Score = 29.9 bits (64), Expect = 2.7
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = -3

Query: 804 KCRIGRLKMILTFVDF*EKRFDTVQWSKMWTLL 706
           KC+     +  TFVD   K FDTV  S +WT++
Sbjct: 427 KCQEQHTALFTTFVDL-TKAFDTVSRSGLWTIM 458


>SB_55051| Best HMM Match : RVT_1 (HMM E-Value=0.014)
          Length = 372

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 47/168 (27%), Positives = 76/168 (45%), Gaps = 5/168 (2%)
 Frame = -3

Query: 492 SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN---T 322
           S + + DL +ADD  L   +   +Q  ++    +    GL+INT KT  M   +     T
Sbjct: 135 SADTVNDLLFADDCALNATSQADLQHSVDLFSSACNNFGLKINTKKTEAMHQPAPGKPYT 194

Query: 321 TP-LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
            P + +         +    G  LS     D+++  R+  A  AF +L K VW+   +  
Sbjct: 195 EPNIIINGQKLNAVDKFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRT 254

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             K+ ++ ++V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 255 DTKIKVYRAVVLPTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 302



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 18/58 (31%), Positives = 32/58 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P+K I I++ L+ G    V  +        ++ GVKQGC+L+P LF ++   ++ +
Sbjct: 46  GCPSKFINIVRQLHDGMLASVQDNGETSHSFPVSNGVKQGCVLAPTLFSLMFSAMLTD 103


>SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1395

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 47/168 (27%), Positives = 76/168 (45%), Gaps = 5/168 (2%)
 Frame = -3

Query: 492  SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN---T 322
            S + + DL +ADD  L   +   +Q  ++    +    GL+INT KT  M   +     T
Sbjct: 812  SADTVNDLLFADDCALNATSQADLQHSVDLFSSACNNFGLKINTKKTEAMHQPAPGKPYT 871

Query: 321  TP-LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
             P + +         +    G  LS     D+++  R+  A  AF +L K VW+   +  
Sbjct: 872  EPNIIINGQKLNAVDKFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIKT 931

Query: 147  RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
              K+ ++ ++V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 932  DTKIKVYRAVVLPTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 979



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 18/58 (31%), Positives = 32/58 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P+K I I++ L+ G    V  +        ++ GVKQGC+L+P LF ++   ++ +
Sbjct: 723 GCPSKFINIVRQLHDGMLASVQDNGETSHFFPVSNGVKQGCVLAPTLFSLMFSAMLTD 780


>SB_2372| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)
          Length = 414

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 47/168 (27%), Positives = 76/168 (45%), Gaps = 5/168 (2%)
 Frame = -3

Query: 492 SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN---T 322
           S + + DL +ADD  L   +   +Q  ++    +    GL+INT KT  M   +     T
Sbjct: 94  SADTVNDLLFADDCALNATSQADLQHSVDLFSSACNNFGLKINTKKTEAMHQPAPGKPYT 153

Query: 321 TP-LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
            P + +         +    G  LS     D+++  R+  A  AF +L K VW+   +  
Sbjct: 154 EPNIIINGQKLNAVDKFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRT 213

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             K+ ++ ++V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 214 DTKIKVYRAVVLPTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 261



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 18/58 (31%), Positives = 32/58 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P+K I I++ L+ G    V  +        ++ GVKQGC+L+P LF ++   ++ +
Sbjct: 5   GCPSKFINIVRQLHDGMLASVQDNGETSHSFPVSNGVKQGCVLAPTLFSLMFSAMLTD 62


>SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 356

 Score = 66.5 bits (155), Expect = 3e-11
 Identities = 50/162 (30%), Positives = 74/162 (45%), Gaps = 5/162 (3%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK--- 310
           L  L +ADD  L   T  +MQ  +     +    GL I+T KT  M   + NT  ++   
Sbjct: 45  LRVLLFADDCALNANTGLEMQESVNKFSDACNNFGLTISTKKTEVMLQPAPNTPYMEPEI 104

Query: 309 -LQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKL 136
            +         +    G  LS     D+++  RI KA  +F +L K VW    ++   KL
Sbjct: 105 YINSQRLNPVEKFTYLGSTLSRVIHIDDEVNARIAKASASFGRLSKTVWNRRGISTETKL 164

Query: 135 TLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRI 10
            ++ +IV + LL+ CETW V +    +L  F   CLR IL I
Sbjct: 165 GVYRAIVLTSLLYACETWTVYQRHARKLNHFHTICLRKILGI 206


>SB_2707| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 86

 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 27/58 (46%), Positives = 39/58 (67%)
 Frame = -3

Query: 174 VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFWP 1
           +W SS ++   K+ LF++ VK +LL+G ETWR T     ++ VF+N CLR IL+I WP
Sbjct: 2   IWGSSEISITTKIRLFNTTVKPILLYGAETWRTTVITMKKIPVFINTCLRKILKIRWP 59


>SB_10586| Best HMM Match : RVT_1 (HMM E-Value=0.039)
          Length = 590

 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 46/160 (28%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M + +  T  L    
Sbjct: 320 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCIGNTPTFMLMALS 379

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
           C             +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 380 C-------------ILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 426

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +LL+G ETW V +     L+    + LR IL+I W
Sbjct: 427 QCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRLILKIKW 466



 Score = 28.7 bits (61), Expect = 6.1
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = -1

Query: 635 VVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           ++ D  L    E   GVKQGC L+P LF
Sbjct: 245 LIVDGELTRAFEYNCGVKQGCKLAPTLF 272


>SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 534

 Score = 65.3 bits (152), Expect = 6e-11
 Identities = 50/162 (30%), Positives = 73/162 (45%), Gaps = 5/162 (3%)
 Frame = -3

Query: 474 DLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK----L 307
           D D   DI   T  L+ MQ  +     +    GL I+T KT  M   + NT  ++    +
Sbjct: 258 DNDPGIDIKFRTEGLE-MQESVNKFSDACNNFGLTISTKKTEVMLQPAPNTPYMEPEIYI 316

Query: 306 QDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTL 130
                    +    G  LS     D+++  RI KA  +F +L K VW    ++   KL +
Sbjct: 317 NSQRLNPVEKFTYLGSTLSRVIHIDDEVNARIAKASASFGRLSKTVWNRRGISTETKLGV 376

Query: 129 FDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           + +IV + LL+ CETW V +    +L  F   CLR IL I W
Sbjct: 377 YRAIVLTSLLYACETWTVYQRHARKLNHFHTICLRKILGIKW 418



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 23/80 (28%), Positives = 42/80 (52%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           G P +   +++  + G    V+ D    AP ++T GVKQGC+L+P LF M+   ++ +  
Sbjct: 197 GCPPRFTSMVRQFHDGMQAHVLEDGNQSAPFQVTNGVKQGCVLAPTLFSMMFTAMLADAY 256

Query: 515 TTLGALNGAKISWKTLTMQM 456
           +      G  I ++T  ++M
Sbjct: 257 SDNDP--GIDIKFRTEGLEM 274



 Score = 29.9 bits (64), Expect = 2.7
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = -3

Query: 804 KCRIGRLKMILTFVDF*EKRFDTVQWSKMWTLL 706
           KC+     +  TFVD   K FDTV  S +WT++
Sbjct: 162 KCQEQHTALFTTFVDL-TKAFDTVSRSGLWTIM 193


>SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 238

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 41/142 (28%), Positives = 65/142 (45%), Gaps = 1/142 (0%)
 Frame = -3

Query: 426 QMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSN 247
           ++Q+ L+    +     L I+  KT  M + S+      + D   +V  +    G   S 
Sbjct: 4   ELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTINDFTLDVVPQFTYLGSTTSA 63

Query: 246 QGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTK 70
            G  D ++  RI KA     +L   VWE+  +T   K+T++ + + S LL+G E+W    
Sbjct: 64  NGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYA 123

Query: 69  TLTNRLQVFVNKCLRSILRIFW 4
               RL  F  +CLR IL I W
Sbjct: 124 RQEKRLNTFHMRCLRRILGIHW 145


>SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 328

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 41/142 (28%), Positives = 65/142 (45%), Gaps = 1/142 (0%)
 Frame = -3

Query: 426 QMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSN 247
           ++Q+ L+    +     L I+  KT  M + S+      + D   +V  +    G   S 
Sbjct: 4   ELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTINDFTLDVVPQFTYLGSTTSA 63

Query: 246 QGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTK 70
            G  D ++  RI KA     +L   VWE+  +T   K+T++ + + S LL+G E+W    
Sbjct: 64  NGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYA 123

Query: 69  TLTNRLQVFVNKCLRSILRIFW 4
               RL  F  +CLR IL I W
Sbjct: 124 RQEKRLHTFHMRCLRRILGIHW 145


>SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 280

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 41/142 (28%), Positives = 65/142 (45%), Gaps = 1/142 (0%)
 Frame = -3

Query: 426 QMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSN 247
           ++Q+ L+    +     L I+  KT  M + S+      + D   +V  +    G   S 
Sbjct: 4   ELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTINDFTLDVVPQFTYLGSTTSA 63

Query: 246 QGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTK 70
            G  D ++  RI KA     +L   VWE+  +T   K+T++ + + S LL+G E+W    
Sbjct: 64  NGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYA 123

Query: 69  TLTNRLQVFVNKCLRSILRIFW 4
               RL  F  +CLR IL I W
Sbjct: 124 RQEKRLNTFHMRCLRRILGIHW 145


>SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46)
          Length = 404

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 43/160 (26%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   N     +  
Sbjct: 123 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNNADFYVDG 180

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 181 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 240

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  + ++G ETW V +           + LR IL+I W
Sbjct: 241 QCLMPLFMYGSETWTVYQHEVREPCTLQQRHLRLILKIKW 280



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 22/52 (42%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I +I+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 24  LGKLGCPPKFISVIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 75


>SB_47925| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 304

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 45/132 (34%), Positives = 68/132 (51%), Gaps = 7/132 (5%)
 Frame = -3

Query: 378 GLRINTNKTVDM------RVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEI 217
           GL I+  KT  M      +  S+ TT +K ++    V T  Y+   L S     D +++ 
Sbjct: 12  GLTISIKKTKVMYQPAPHKAYSEPTTTVKGENLE-AVDTFTYLCSTL-SRSVCIDAEVDG 69

Query: 216 RIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFV 40
           RI KA  AF +L K VW    ++ + KL ++ +IV  +LL+ CETW V  +   +L  F 
Sbjct: 70  RIAKASTAFGRLRKKVWGRRGLSMKTKLKVYKAIVLPLLLYSCETWTVYSSHAKKLDRFH 129

Query: 39  NKCLRSILRIFW 4
             CLR IL++ W
Sbjct: 130 MNCLRKILQVRW 141


>SB_42199| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 206

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 45/132 (34%), Positives = 68/132 (51%), Gaps = 7/132 (5%)
 Frame = -3

Query: 378 GLRINTNKTVDM------RVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEI 217
           GL I+  KT  M      +  S+ TT +K ++    V T  Y+   L S     D +++ 
Sbjct: 12  GLTISIKKTKVMYQPAPHKAYSEPTTTVKGENLE-AVDTFTYLCSTL-SRSVCIDAEVDG 69

Query: 216 RIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFV 40
           RI KA  AF +L K VW    ++ + KL ++ +IV  +LL+ CETW V  +   +L  F 
Sbjct: 70  RIAKASTAFGRLRKKVWGRRGLSMKTKLKVYKAIVLPLLLYSCETWTVYSSHAKKLDRFH 129

Query: 39  NKCLRSILRIFW 4
             CLR IL++ W
Sbjct: 130 MNCLRKILQVRW 141


>SB_14835| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)
          Length = 382

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 47/168 (27%), Positives = 79/168 (47%), Gaps = 5/168 (2%)
 Frame = -3

Query: 492 SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMR--VMSKNTT 319
           S + + DL +ADD  L   +   +Q  ++    +    GL+INT KT  M      K  T
Sbjct: 64  SADTVNDLLFADDCALNATSQADLQHSVDLFSSACNNFGLKINTKKTEAMHQPAPGKPYT 123

Query: 318 PLKLQDCGFEVSTE---VYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTR 148
              +   G +++     +Y+ G  LS     D+++  R+  A  AF +L+ +    + T 
Sbjct: 124 EPNIIINGQKLNAVDKFIYL-GSTLSRNVVLDDEVTNRLAIASAAFGRLQRLKRRGIRTD 182

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             K+ ++ ++V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 183 T-KIKVYRAVVLPTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 229


>SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 238

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 41/142 (28%), Positives = 65/142 (45%), Gaps = 1/142 (0%)
 Frame = -3

Query: 426 QMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSN 247
           ++Q+ L+    +     L I+  KT  M + S+      + D   +V  +    G   S 
Sbjct: 4   ELQSLLDRFLNACADFSLAISLKKTKVMHLGSEIAPTFTINDFTLDVVPQFTYLGSTTSA 63

Query: 246 QGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTK 70
            G  D ++  RI KA     +L   VWE+  +T   K+T++ + + S LL+G E+W    
Sbjct: 64  NGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYA 123

Query: 69  TLTNRLQVFVNKCLRSILRIFW 4
               RL  F  +CLR IL I W
Sbjct: 124 RQEKRLHTFHMRCLRRILGIHW 145


>SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 686

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 48/168 (28%), Positives = 87/168 (51%), Gaps = 6/168 (3%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK 310
           E ++ D  +AD   LM    + +Q  ++    +++  GL I+ +KT  +   + ++ P +
Sbjct: 314 ERLILDALFADYCALMAHQENHLQTIVDKFSEASKLFGLTISLSKTEVLFQPAPDSIPQQ 373

Query: 309 --LQDCGFE---VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
             +   G +   V + VY+ G  +SN    D++I  RI+KA  A  +L   V +   +  
Sbjct: 374 PCITIDGTQLKNVDSFVYL-GSTISNDNTLDKEIAARIQKASHALGKLCTKVLQHQDIRL 432

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             KL ++++IV   LL+GCETW + +    +L  F  + LR+I+RI W
Sbjct: 433 STKLKVYNAIVLPSLLYGCETWTLYRRHIKKLGQFHTRSLRAIMRIRW 480



 Score = 32.7 bits (71), Expect = 0.38
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 3/39 (7%)
 Frame = -1

Query: 614 GAPIE---MTAGVKQGCLLSPLLFIMLLDDIMREVVTTL 507
           G P+E   ++ GVKQGC+L+P+LF +    ++   V  L
Sbjct: 248 GEPVESFSISNGVKQGCVLAPVLFNLFFTQVLLHAVRDL 286


>SB_36804| Best HMM Match : tRNA_int_endo (HMM E-Value=3.9)
          Length = 229

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 48/168 (28%), Positives = 87/168 (51%), Gaps = 6/168 (3%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK 310
           E ++ D  +AD   LM    + +Q  ++    +++  GL I+ +KT  +   + ++ P +
Sbjct: 2   ERLILDALFADYCALMAHQENHLQTIVDKFSEASKLFGLTISLSKTEVLFQPAPDSIPQQ 61

Query: 309 --LQDCGFE---VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
             +   G +   V + VY+ G  +SN    D++I  RI+KA  A  +L   V +   +  
Sbjct: 62  PCITIDGTQLKNVDSFVYL-GSTISNDNTLDKEIAARIQKASHALGKLCTKVLQHQDIRL 120

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             KL ++++IV   LL+GCETW + +    +L  F  + LR+I+RI W
Sbjct: 121 STKLKVYNAIVLPSLLYGCETWTLYRRHIKKLGQFHTRSLRAIMRIRW 168


>SB_14108| Best HMM Match : zf-C2H2 (HMM E-Value=0.13)
          Length = 404

 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = -3

Query: 228 DIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRL 52
           +I  RI KA  AF +L K VWE   +++  K+ ++ ++V + LL+GCETW + +     L
Sbjct: 171 EINNRIAKASSAFGRLRKSVWERRGISQCTKIKVYRAVVLTTLLYGCETWTIYRRHEKLL 230

Query: 51  QVFVNKCLRSILRIFW 4
           Q F  +CLR+IL I W
Sbjct: 231 QQFHLRCLRNILNIRW 246


>SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 288

 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 1/125 (0%)
 Frame = -3

Query: 375 LRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARG 196
           L I+  KT  M + S+      + D   +V  +    G   S  G  D ++  RI KA  
Sbjct: 20  LAISLKKTKVMHLGSEIAPTFTINDFTLDVVPQFTYLGSTTSANGCLDVELGKRIGKAVT 79

Query: 195 AFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSI 19
             ++L   VWE+  +T   K+T++ + + S LL+G E+W        RL  F  +CLR I
Sbjct: 80  TMSKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRI 139

Query: 18  LRIFW 4
           L I W
Sbjct: 140 LGIHW 144


>SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1319

 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = -3

Query: 228  DIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRL 52
            +I  RI KA  AF +L K VWE   +++  K+ ++ ++V + LL+GCETW + +     L
Sbjct: 1086 EINNRIAKASSAFGRLRKSVWERRGISQCTKIKVYRAVVLTTLLYGCETWTIYRRHEKLL 1145

Query: 51   QVFVNKCLRSILRIFW 4
            Q F  +CLR+IL I W
Sbjct: 1146 QQFHLRCLRNILNIRW 1161


>SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1)
          Length = 173

 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 40/142 (28%), Positives = 65/142 (45%), Gaps = 1/142 (0%)
 Frame = -3

Query: 426 QMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSN 247
           ++Q+ L+    +     L I+  KT  M + S+      + D   +V  +    G   S 
Sbjct: 4   ELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTINDFTLDVVPQFTYLGSTTSA 63

Query: 246 QGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTK 70
            G  D ++  RI KA     +L   VWE+  +T   K+T++ + + + LL+G E+W    
Sbjct: 64  NGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACILNTLLYGSESWTTYA 123

Query: 69  TLTNRLQVFVNKCLRSILRIFW 4
               RL  F  +CLR IL I W
Sbjct: 124 RQEKRLNTFHMRCLRRILGIHW 145


>SB_29299| Best HMM Match : RVT_1 (HMM E-Value=0.00029)
          Length = 298

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 28/57 (49%), Positives = 40/57 (70%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
           LK  GIP+KI+ +IQ +Y G   RV+ +  +    EM  GV++GCLLSPLLF+++LD
Sbjct: 122 LKHYGIPSKILKMIQVIYDGFQARVLFEGKMSEAFEMQTGVRKGCLLSPLLFLIVLD 178



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 40/107 (37%), Positives = 62/107 (57%), Gaps = 3/107 (2%)
 Frame = -3

Query: 516 DNTRGIEWSENIL-EDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMR 340
           +N  GI++S     EDL++ADDIVL++  +   + K E L+  A K GL++   KT  MR
Sbjct: 187 ENKTGIQFSLMTKPEDLEFADDIVLLSQKIAHARNKFEALQKEAAK-GLKVKNIKTKKMR 245

Query: 339 V-MSKNTTPLKLQDCGFE-VSTEVYISGELLSNQGGSDEDIEIRIRK 205
           +  +KN   +  +D   E V +  Y+ G +++  GGS ED+E R RK
Sbjct: 246 ISTTKNAGAIMCKDQPLERVESFTYL-GSIVNTTGGSGEDVEARCRK 291


>SB_47792| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6)
          Length = 255

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 37/154 (24%), Positives = 80/154 (51%), Gaps = 7/154 (4%)
 Frame = -3

Query: 444 MTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNTTPLKLQDCGFEVS 283
           M   ++ MQ  ++    +AE+  L+IN  KT      V  + +++    + +++     +
Sbjct: 1   MIYVVESMQRLVDRFSSAAEQFSLKINIKKTECLFQPVKRQTLTQFPGEIHVRNETLVQT 60

Query: 282 TEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSV 106
            +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ ++K  ++ ++V S 
Sbjct: 61  KDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLKVKGKVYRAVVLSA 120

Query: 105 LLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           L++G ETW V ++    L  ++ + LR I++I W
Sbjct: 121 LVYGAETWTVYRSQVKNLHAYMMRHLREIMKITW 154


>SB_9821| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 203

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 36/107 (33%), Positives = 61/107 (57%)
 Frame = -1

Query: 776 FLRLLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEM 597
           ++  + F+K+  +L+        L+  G+P+K++ +I+  Y+   C V+ D  L     +
Sbjct: 69  YINFIDFKKAFDSLHRNT-LWKILRYYGVPSKLVTLIELFYQHFECSVILDGHLSEWFPV 127

Query: 596 TAGVKQGCLLSPLLFIMLLDDIMREVVTTLGALNGAKISWKTLTMQM 456
            +GV+QGC++SPLLF++ +D IMR   TT     G  I W TLT Q+
Sbjct: 128 NSGVRQGCIISPLLFLLAIDWIMRN--TTADKPRG--IQW-TLTSQL 169



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = -3

Query: 522 SGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLED 403
           + D  RGI+W+  + LEDLD+A DI +++  +   + +L D
Sbjct: 154 TADKPRGIQWTLTSQLEDLDFAYDIAVLSSIVSICKKRLTD 194


>SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43)
          Length = 661

 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 42/159 (26%), Positives = 68/159 (42%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + DL +ADD  L+  +  ++Q+ L+    +     L I+  KT  M + S+      + D
Sbjct: 371 IRDLLFADDAALVAHSESELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTIND 430

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDS 121
              +V  +    G   S  G  D    +              VWE+  +T   K+T++ +
Sbjct: 431 FTLDVVPQFTYLGSTTSANGCLD----VXXXXVTTMTKLSSRVWENKKLTISTKITVYRA 486

Query: 120 IVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 487 CILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 525



 Score = 37.9 bits (84), Expect = 0.010
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           G P K++  I++ + G+   V  +       ++  GVKQGC+L+P LF +    ++R
Sbjct: 278 GCPPKLLNFIKSFHDGTRGTVKCESNSSEAFDINIGVKQGCVLAPTLFNIFFSVLLR 334


>SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 636

 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 45/160 (28%), Positives = 76/160 (47%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 358 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 415

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 416 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 475

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +L    ETW V +     L+    + LR IL+I W
Sbjct: 476 QCLMPLLF---ETWTVYQHEVRELRTLQQRHLRLILKIKW 512



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 259 LGKLGCPPKFISIIKKLYSDVYARLIVDGELTRAFEYNCGVKQGCKLAPTLF 310


>SB_43040| Best HMM Match : L_lactis_RepB_C (HMM E-Value=3.4)
          Length = 267

 Score = 61.7 bits (143), Expect = 7e-10
 Identities = 37/112 (33%), Positives = 59/112 (52%), Gaps = 1/112 (0%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G G+N  GI W   + L+DLD+ADDI L++ T   +Q K   L   A + GL+IN  K
Sbjct: 8   SVGKGEN--GIRWKFTSKLDDLDFADDIALLSSTKHHIQEKTAKLDGEARRAGLKINLEK 65

Query: 354 TVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKAR 199
           T  +R+ +K    + +     E  +E    G  +  +GG  +D+  R+ +AR
Sbjct: 66  TKMLRINAKQHGNIVINGKEIEDVSEFTYLGAKVFREGGGMKDLRNRLSEAR 117


>SB_50753| Best HMM Match : zf-C2H2 (HMM E-Value=0.012)
          Length = 401

 Score = 61.7 bits (143), Expect = 7e-10
 Identities = 34/97 (35%), Positives = 57/97 (58%), Gaps = 1/97 (1%)
 Frame = -3

Query: 291 EVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIV 115
           +V + VY+ G  +SN    D++I  RI+KA  A  +L+  V +   +    KL ++++IV
Sbjct: 156 DVDSFVYL-GSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRLSTKLKVYNAIV 214

Query: 114 KSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
              LL+GCETW + +    +L+ F  + LR+I+RI W
Sbjct: 215 LPSLLYGCETWTLYRRHIKKLEQFHTRSLRAIMRIRW 251


>SB_50090| Best HMM Match : SPC22 (HMM E-Value=2.8)
          Length = 268

 Score = 61.7 bits (143), Expect = 7e-10
 Identities = 37/146 (25%), Positives = 79/146 (54%), Gaps = 7/146 (4%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
           I+ ++ YADD VL+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++  
Sbjct: 122 IVREMLYADDSVLVAHDVESMQRLVDRFSSAAEQFSLKINIKKTECLFQPVKRQTLTQFP 181

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
             + +++     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ +
Sbjct: 182 GEIHVRNETLVQTKDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLK 241

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKT 67
           +K  ++ ++V S L++G ETW V ++
Sbjct: 242 VKGKVYRAVVLSALVYGAETWTVYRS 267



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           G P K + +I++L+ G    V          +++ GVKQGC+L+P LF + L  ++
Sbjct: 30  GCPPKFVNVIRSLHSGMKASVSQGGNDSKQFDVSNGVKQGCVLAPTLFSLYLSAML 85


>SB_25362| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6)
          Length = 185

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 36/146 (24%), Positives = 78/146 (53%), Gaps = 7/146 (4%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
           I+ ++ YADD  L+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++  
Sbjct: 39  IVREMLYADDSALVAHDVESMQRLVDRFSSAAEQFSLKINIKKTECLFQPVKRQTLTRFP 98

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
             + +++     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ +
Sbjct: 99  GEIHVRNETLVQTKDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLK 158

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKT 67
           +K  ++ ++V S L++G ETW V ++
Sbjct: 159 VKGKVYRAVVLSALVYGAETWTVYRS 184


>SB_11573| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 405

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 37/112 (33%), Positives = 57/112 (50%), Gaps = 1/112 (0%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G G+N  GI W   + L+DLD+ADD  L++ T   +Q K   L   A + GL+IN  K
Sbjct: 8   SVGKGEN--GIRWKFTSKLDDLDFADDKALLSSTKHHIQEKTAKLDGEARRAGLKINLEK 65

Query: 354 TVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKAR 199
           T  +R+ +K    + +     E   E    G  +  +GG  +D+  R+ KAR
Sbjct: 66  TKMLRINAKQHGNIVINGKEIEDVIEFTYLGAKVCREGGGMKDLRNRLSKAR 117


>SB_10659| Best HMM Match : PAPA-1 (HMM E-Value=0.75)
          Length = 498

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 36/146 (24%), Positives = 78/146 (53%), Gaps = 7/146 (4%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
           I+ ++ YADD  L+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++  
Sbjct: 352 IVREMLYADDSALVAHDVESMQRLVDRFSSAAEQFSLKINIKKTECLFQPVKRQTLTQFP 411

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
             + +++     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ +
Sbjct: 412 GEIHVRNETLVQTKDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLK 471

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKT 67
           +K  ++ ++V S L++G ETW V ++
Sbjct: 472 VKGKVYRAVVLSALVYGAETWTVYRS 497


>SB_7036| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6)
          Length = 268

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 36/146 (24%), Positives = 78/146 (53%), Gaps = 7/146 (4%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
           I+ ++ YADD  L+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++  
Sbjct: 122 IVREMLYADDSALVAHDVESMQRLVDRFSSAAEQFSLKINIKKTECLFQPVKRQTLTQFP 181

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
             + +++     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ +
Sbjct: 182 GEIHVRNETLVQTKDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLK 241

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKT 67
           +K  ++ ++V S L++G ETW V ++
Sbjct: 242 VKGKVYRAVVLSALVYGAETWTVYRS 267



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           G P K + +I++L+ G    V          +++ GVKQGC+L+P LF + L  ++
Sbjct: 30  GCPPKFVNVIRSLHSGMKASVSQGGNDSKQFDVSNGVKQGCVLAPTLFSLYLSAML 85


>SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 1/140 (0%)
 Frame = -3

Query: 426 QMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSN 247
           ++Q+ L+    +     L I+  KT  M + S+      + D   +V  +    G   S 
Sbjct: 4   ELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTINDFTLDVVPQFTYLGSTTSA 63

Query: 246 QGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTK 70
            G  D ++  RI KA     +L   VWE+  +T   K+T++ + + S LL+G E+W    
Sbjct: 64  NGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYA 123

Query: 69  TLTNRLQVFVNKCLRSILRI 10
               RL  F  +CLR IL I
Sbjct: 124 RQEKRLHTFHMRCLRRILGI 143


>SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)
          Length = 1443

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 49/165 (29%), Positives = 76/165 (46%), Gaps = 7/165 (4%)
 Frame = -3

Query: 477  EDLDYADDIVLMTPTLDQMQAKLEDLRISA-EKRGLRINTNKTVDMR--VMSKNTTPLKL 307
            +++D     V +T   D       DL  SA    GL+INT KT  M      K  T   +
Sbjct: 1127 QNVDLYSTYVDLTKAFDTTWQHSVDLFSSACNNFGLKINTKKTEAMHQPAPGKPYTEPNI 1186

Query: 306  QDCGFEVSTE---VYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIK 139
               G +++     +Y+ G  LS     D+++  R+  A  AF +L K VW+   +    K
Sbjct: 1187 IINGQKLNAVDKFIYL-GSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTK 1245

Query: 138  LTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
            + ++ ++V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 1246 IKVYRAVVLPTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 1290


>SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 1/140 (0%)
 Frame = -3

Query: 426 QMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSN 247
           ++Q+ L+    +     L I+  KT  M + S+      + D   +V  +    G   S 
Sbjct: 4   ELQSLLDRFSNACADFSLAISLKKTKVMHLGSEIAPTFTINDFTLDVVPQFTYLGSTTSA 63

Query: 246 QGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTK 70
            G  D ++  RI KA     +L   VWE+  +T   K+T++ + + S LL+G E+W    
Sbjct: 64  NGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYA 123

Query: 69  TLTNRLQVFVNKCLRSILRI 10
               RL  F  +CLR IL I
Sbjct: 124 RQEKRLHTFHMRCLRRILGI 143


>SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1766

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 46/168 (27%), Positives = 74/168 (44%), Gaps = 5/168 (2%)
 Frame = -3

Query: 492  SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN---T 322
            S + + DL +ADD  L   +   +Q  ++    + +  GL+INT KT  M   +     T
Sbjct: 677  SADTINDLLFADDCALNATSQADLQHSVDLFSSACKNFGLKINTKKTEAMHQPAPGKPYT 736

Query: 321  TP-LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTR 148
             P + +         +    G  LS     D+ +  R+  A  AF +L K VWE   +  
Sbjct: 737  EPNIIINGQKLNAVDKFTYLGSTLSRNVVLDDQVTNRLAIASAAFGRLRKNVWERRGIRT 796

Query: 147  RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
              K+ ++ ++V   LL+G E   + K    +L  F   CLR IL + W
Sbjct: 797  DPKIKVYRAVVLPTLLYGSEPGTIYKRHAMKLNHFHTTCLRKILNVRW 844



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P+K I I++ L+ G    V  +        ++ GVKQGC+L+P LF +L   ++ +
Sbjct: 588 GCPSKFINIVRQLHDGMLASVQDNGETSHSFPVSNGVKQGCVLAPTLFSLLFSAMLTD 645


>SB_37284| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1031

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 1/66 (1%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQV-LGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
            L+  GIPNKII +I   Y    C V+ +      P  + +GV+QGC+LSP+LF++ +D I
Sbjct: 936  LESYGIPNKIITLINLFYSNFECSVITNNTNTSEPFPVNSGVRQGCILSPILFLVAIDWI 995

Query: 530  MREVVT 513
            MR+  +
Sbjct: 996  MRQTTS 1001


>SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05)
          Length = 666

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = -3

Query: 174 VWESSVM--TRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFWP 1
           +W+S+    + + KL L++S VKSVLL+G E W + K   +++  F N CLR I RIFWP
Sbjct: 501 IWDSNSKQYSLKTKLRLYNSNVKSVLLYGSECWSIVKADMDKISAFHNVCLRKICRIFWP 560


>SB_52531| Best HMM Match : RVT_1 (HMM E-Value=1e-08)
          Length = 309

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 42/142 (29%), Positives = 77/142 (54%), Gaps = 6/142 (4%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK 310
           E ++ D  +ADD  LM    + +Q  ++    +++  GL+I+ +KT  +   + ++TP +
Sbjct: 165 ERLILDALFADDCALMAHQENHLQTIVDKFSEASKLFGLKISLSKTEVLLQPAPDSTPQQ 224

Query: 309 --LQDCGFE---VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTR 148
             +   G +   V + VY+ G  +SN    D++I  RI+KA  A  +L+  V +   +  
Sbjct: 225 PCITIDGTQLKNVDSFVYL-GSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRL 283

Query: 147 RIKLTLFDSIVKSVLLFGCETW 82
             KL ++++IV   LL+GCETW
Sbjct: 284 STKLKVYNAIVLPSLLYGCETW 305



 Score = 37.1 bits (82), Expect = 0.018
 Identities = 19/67 (28%), Positives = 32/67 (47%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L + G P K   +I+  +   T  V+ D        ++ GVKQ C+L+P+LF +    ++
Sbjct: 71  LSKLGCPAKFTTLIRLFHDDMTGEVLSDGEPSESFSISNGVKQACVLAPVLFNLFFTQVL 130

Query: 527 REVVTTL 507
              V  L
Sbjct: 131 LHAVRDL 137


>SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 675

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 44/160 (27%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 397 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 454

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 455 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 514

Query: 123 SIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             +  +L    ETW V +     L+    + LR I +I W
Sbjct: 515 QCLMPLLF---ETWTVYQHEVRELRTLQQRHLRLIPQIKW 551



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 298 LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 349


>SB_24134| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6)
          Length = 268

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 41/147 (27%), Positives = 80/147 (54%), Gaps = 8/147 (5%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT--VDMRVMSKNTT--P 316
           I+ ++ YADD  L+   ++ MQ  ++    +AE+  L+IN  KT  +   V  K +T  P
Sbjct: 122 IVREMLYADDNALVAHDVESMQRLVDRFSSAAEQFRLKINIKKTECLFQPVKRKTSTQFP 181

Query: 315 LKLQ---DCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTR 148
            ++    +   +    VY+ G  +S+    D +I  R  KA  A+A+L+  +W++  ++ 
Sbjct: 182 GEIHVRNETLVQTKDFVYL-GSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSL 240

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKT 67
           ++K  ++ ++V S L++G ETW V ++
Sbjct: 241 KVKGKVYRAVVLSALVYGAETWTVYRS 267



 Score = 35.1 bits (77), Expect = 0.071
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           G P K + +I++L+ G    V          +++ GVKQG +L+P LF + L  ++
Sbjct: 30  GCPPKFVNVIRSLHSGMKASVSQGGNDSKQFDVSNGVKQGWVLAPTLFSLYLSAML 85


>SB_14815| Best HMM Match : RVT_1 (HMM E-Value=1.4)
          Length = 331

 Score = 58.0 bits (134), Expect = 9e-09
 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -3

Query: 504 GIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSK 328
           GI W      EDLD+ADDI L++    QMQ K + L  +A+K GL I+ +KT  ++V  K
Sbjct: 171 GIRWKFYTQQEDLDFADDIALISTNHSQMQKKTDKLSETAQKVGLNISQSKTRVLKVNCK 230

Query: 327 NTTPLKLQD 301
           N  P+KLQ+
Sbjct: 231 NPEPIKLQN 239


>SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085)
          Length = 576

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 47/158 (29%), Positives = 74/158 (46%), Gaps = 10/158 (6%)
 Frame = -3

Query: 447 LMTPTLDQM--QAKLEDL--RISAEKR-GLRINTNKTVDMRVMSKN---TTP-LKLQDCG 295
           ++ PTL  +   A L D+   +SA K  GL+INT KT  M   +     T P + +    
Sbjct: 277 VLAPTLFSLLFSAMLTDVLKMMSACKNFGLKINTKKTEAMHQPAPGKPYTEPNIIINGQK 336

Query: 294 FEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSI 118
                +    G  LS     D+++  R+  A  AF +L K +W+   +    K+ ++ ++
Sbjct: 337 LNAVDKFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNIWKRRGIRTDTKIKVYRAV 396

Query: 117 VKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           V   LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 397 VLPTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 434



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           G P+K I I++ L+ G    V  +        ++ GVKQGC+L+P LF +L   ++ +V+
Sbjct: 236 GCPSKFINIVRQLHDGMLASVQDNGETSHSFPVSNGVKQGCVLAPTLFSLLFSAMLTDVL 295

Query: 515 TTLGALN--GAKISWK 474
             + A    G KI+ K
Sbjct: 296 KMMSACKNFGLKINTK 311


>SB_19159| Best HMM Match : RVT_1 (HMM E-Value=0.00032)
          Length = 426

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 27/92 (29%), Positives = 55/92 (59%), Gaps = 1/92 (1%)
 Frame = -3

Query: 276 VYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLL 100
           VY+ G  +S+    D +I  R  KA  A+A+L+  +W++  ++ ++K  ++ ++V S L+
Sbjct: 235 VYL-GSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLKVKGKVYRAVVLSALV 293

Query: 99  FGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +G ETW V ++    L  ++ + L+ I++I W
Sbjct: 294 YGAETWTVYRSQVKNLHAYMMRHLKEIMKITW 325



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           G P K + +I++L+ G    V          +++ GVKQGC+L+P LF + L  ++
Sbjct: 98  GCPPKFVNVIRSLHSGMKASVSQGGNDSKQFDVSNGVKQGCVLAPTLFSLYLSAML 153


>SB_10529| Best HMM Match : zf-C2H2 (HMM E-Value=0.0034)
          Length = 272

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 30/92 (32%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = -3

Query: 276 VYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLL 100
           +Y+ G  LS     D+++  R+ +A  AF +L K VW+   +    K+ ++ ++V   LL
Sbjct: 29  IYL-GSTLSRNVVLDDEVTNRLARASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLPTLL 87

Query: 99  FGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +G ETW + K    +L  F   CLR IL + W
Sbjct: 88  YGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 119


>SB_43443| Best HMM Match : Phage_fiber (HMM E-Value=3.8)
          Length = 266

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 42/155 (27%), Positives = 81/155 (52%), Gaps = 6/155 (3%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK 310
           E ++ D  +ADD  LM    + +Q  ++    +++  GL I+ +KT  +   + ++ P +
Sbjct: 88  ERLILDALFADDCALMAHQENHLQTIVDKFSEASKLFGLTISLSKTEVLFQPAPDSIPQQ 147

Query: 309 --LQDCGFEVS---TEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTR 148
             +   G ++    + VY+ G  +SN    D++I  RI+KA  A  +L+  V +   +  
Sbjct: 148 PCITIDGTQLKNLDSFVYL-GSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRL 206

Query: 147 RIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVF 43
             KL ++++IV   LL+GCETW + +    +L+ F
Sbjct: 207 STKLKVYNAIVLPSLLYGCETWTLYRRHIKKLEQF 241



 Score = 31.9 bits (69), Expect = 0.66
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = -1

Query: 644 TCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVVTTL 507
           T  V+ D        ++ GVKQGC+L+P+LF +    ++   V  L
Sbjct: 15  TGEVLSDGEPSESFSVSNGVKQGCVLAPVLFNLFFTQVLLHAVRDL 60


>SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 249

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 1/126 (0%)
 Frame = -3

Query: 378 GLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKAR 199
           G+RINT KT  M +   NT    +        T     G +LS+      ++  RI+   
Sbjct: 2   GIRINTKKTETMCI--GNTADFYVDGIKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVS 59

Query: 198 GAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRS 22
            A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L+    + LR 
Sbjct: 60  CAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRL 119

Query: 21  ILRIFW 4
           IL+I W
Sbjct: 120 ILKIMW 125


>SB_13171| Best HMM Match : AT_hook (HMM E-Value=6.4)
          Length = 188

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 25/85 (29%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = -3

Query: 255 LSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCETWR 79
           +S+    D +I  R  KA  A+A+L+  +W++  ++ ++K  ++ ++V S L++G ETW 
Sbjct: 3   ISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLKVKGKVYRAVVLSALVYGAETWT 62

Query: 78  VTKTLTNRLQVFVNKCLRSILRIFW 4
           V ++    L  ++ + LR I++I W
Sbjct: 63  VYRSQVKNLHAYMMRHLREIMKITW 87


>SB_35729| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)
          Length = 237

 Score = 55.2 bits (127), Expect = 6e-08
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = -3

Query: 234 DEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTN 58
           DE +  R+ +A  AF +L K VW+   +    K+ ++ ++V   LL+G ETW + K    
Sbjct: 7   DESLPTRLARASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLPTLLYGSETWTIYKRHAM 66

Query: 57  RLQVFVNKCLRSILRIFW 4
           +L  F   CLR IL + W
Sbjct: 67  KLNHFHTTCLRKILNVRW 84


>SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 202

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 1/126 (0%)
 Frame = -3

Query: 378 GLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKAR 199
           G+RINT KT  M +   NT    +        T     G +LS+      ++  RI+   
Sbjct: 2   GMRINTKKTETMCI--GNTADFYVDGIKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVS 59

Query: 198 GAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRS 22
            A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L+    + LR 
Sbjct: 60  CAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRL 119

Query: 21  ILRIFW 4
           IL+I W
Sbjct: 120 ILKIKW 125


>SB_56412| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 249

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 1/126 (0%)
 Frame = -3

Query: 378 GLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKAR 199
           G+RINT KT  M +   NT    +        T     G +LS+      ++  RI+   
Sbjct: 2   GMRINTKKTETMCI--GNTADFYVDGIKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVS 59

Query: 198 GAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRS 22
            A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L+    + LR 
Sbjct: 60  CAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRL 119

Query: 21  ILRIFW 4
           IL+I W
Sbjct: 120 ILKIKW 125


>SB_47109| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 360

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = -3

Query: 276 VYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLL 100
           +Y+ G  LS     D+++  R+  A  AF +L K VW+   +    K+ ++ ++V   LL
Sbjct: 29  IYL-GSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLPTLL 87

Query: 99  FGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +G ETW + K    +L  F   CLR IL + W
Sbjct: 88  YGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 119


>SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 249

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 1/126 (0%)
 Frame = -3

Query: 378 GLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKAR 199
           G+RINT KT  M +   NT    +        T     G +LS+      ++  RI+   
Sbjct: 2   GMRINTKKTETMCI--GNTVDFYVDGIKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVS 59

Query: 198 GAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRS 22
            A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L+    + LR 
Sbjct: 60  CAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRL 119

Query: 21  ILRIFW 4
           IL+I W
Sbjct: 120 ILKIKW 125


>SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 249

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 1/126 (0%)
 Frame = -3

Query: 378 GLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKAR 199
           G+RINT KT  M +   NT    +        T     G +LS+      ++  RI+   
Sbjct: 2   GMRINTKKTETMCI--GNTADFYVDGIKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVS 59

Query: 198 GAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRS 22
            A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L+    + LR 
Sbjct: 60  CAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRL 119

Query: 21  ILRIFW 4
           IL+I W
Sbjct: 120 ILKIKW 125


>SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 249

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 1/126 (0%)
 Frame = -3

Query: 378 GLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKAR 199
           G+RINT KT  M +   NT    +        T     G +LS+      ++  RI+   
Sbjct: 2   GMRINTKKTETMCI--GNTADFYVDGIKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVS 59

Query: 198 GAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRS 22
            A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L+    + LR 
Sbjct: 60  CAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRL 119

Query: 21  ILRIFW 4
           IL+I W
Sbjct: 120 ILKIKW 125


>SB_20661| Best HMM Match : DUF1274 (HMM E-Value=8.7)
          Length = 208

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 37/133 (27%), Positives = 65/133 (48%), Gaps = 1/133 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 78  IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 135

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++
Sbjct: 136 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYN 195

Query: 123 SIVKSVLLFGCET 85
             +  +LL+G  T
Sbjct: 196 QCLMPLLLYGSTT 208



 Score = 29.5 bits (63), Expect = 3.5
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -1

Query: 623 QVLGAPIEMTAGVKQGCLLSPLLF 552
           Q+    + ++ GVKQGC L+P LF
Sbjct: 7   QITTGSVSVSCGVKQGCKLAPTLF 30


>SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 203

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 1/126 (0%)
 Frame = -3

Query: 378 GLRINTNKTVDMRVMSKNTTPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKAR 199
           G+RINT KT  M +   NT    +        T     G +LS+      ++  RI+   
Sbjct: 2   GMRINTKKTETMCI--GNTADFYVDGIKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVS 59

Query: 198 GAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRS 22
            A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L+    + LR 
Sbjct: 60  CAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVRELRTLQQRHLRL 119

Query: 21  ILRIFW 4
           IL+I W
Sbjct: 120 ILKIKW 125


>SB_14424| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)
          Length = 272

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 29/88 (32%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = -3

Query: 264 GELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCE 88
           G  LS     D+++  R+  A  AF +L K VW+   +    K+ ++ ++V   LL+G E
Sbjct: 32  GSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLPTLLYGSE 91

Query: 87  TWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           TW + K    +L  F   CLR IL + W
Sbjct: 92  TWTIYKRHAMKLNHFHTTCLRKILNVRW 119


>SB_263| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)
          Length = 272

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 29/88 (32%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = -3

Query: 264 GELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCE 88
           G  LS     D+++  R+  A  AF +L K VW+   +    K+ ++ ++V   LL+G E
Sbjct: 32  GSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLPTLLYGSE 91

Query: 87  TWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           TW + K    +L  F   CLR IL + W
Sbjct: 92  TWTIYKRHAMKLNHFHTTCLRKILNVRW 119


>SB_54320| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 246

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = -3

Query: 234 DEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTN 58
           D+++  R+ +A  AF +L K VW+   +    K+ ++ ++V   LL+G ETW + K    
Sbjct: 16  DDEVTNRLARASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLPTLLYGSETWTIYKRHAL 75

Query: 57  RLQVFVNKCLRSILRIFW 4
           +L  F   CLR IL + W
Sbjct: 76  KLNHFHTTCLRKILNVRW 93


>SB_49315| Best HMM Match : Calreticulin (HMM E-Value=0)
          Length = 1086

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = -3

Query: 234 DEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTN 58
           D+++  R+ +A  AF +L K VW+   +    K+ ++ ++V   LL+G ETW + K    
Sbjct: 504 DDEVTNRLARASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLPTLLYGSETWTIYKRHAL 563

Query: 57  RLQVFVNKCLRSILRIFW 4
           +L  F   CLR IL + W
Sbjct: 564 KLNHFHTTCLRKILNVRW 581


>SB_50181| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051)
          Length = 503

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 2/96 (2%)
 Frame = -3

Query: 285 STEVYIS-GELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVK 112
           ST +Y    +LL      D+++  R+  A  AF +L K VW+   +    K+ ++ ++V 
Sbjct: 255 STGIYTQLVDLLPRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVL 314

Query: 111 SVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
             LL+G ETW + K    +L  F   CLR IL + W
Sbjct: 315 PTLLYGSETWTIYKRHAMKLNHFHTTCLRKILNVRW 350


>SB_59249| Best HMM Match : zf-C2H2 (HMM E-Value=0.016)
          Length = 236

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = -3

Query: 234 DEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTN 58
           D+++  R+  A  AF +L K VW+   +    K+ ++ ++V   LL+G ETW + K    
Sbjct: 6   DDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLPTLLYGSETWTIYKRHAM 65

Query: 57  RLQVFVNKCLRSILRIFW 4
           +L  F   CLR IL + W
Sbjct: 66  KLNHFHTTCLRKILNVRW 83


>SB_41734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score = 51.6 bits (118), Expect = 8e-07
 Identities = 34/140 (24%), Positives = 72/140 (51%), Gaps = 7/140 (5%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
           I   + YADD  L+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++  
Sbjct: 17  ITHQMLYADDSALVAHDVESMQRLVDRFSSAAEQFSLKINIKKTECLFQPVKRQTLTQFP 76

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
             + +++     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ +
Sbjct: 77  GEIHVRNETLVQNKDFVNLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLK 136

Query: 144 IKLTLFDSIVKSVLLFGCET 85
           +K  ++ ++V S L++G ET
Sbjct: 137 VKGKVYRAVVLSALVYGAET 156


>SB_6304| Best HMM Match : RVT_1 (HMM E-Value=3.2e-18)
          Length = 404

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G G+N  GI W   + L+DLD+ADDI L++ T   +Q K   L   A + GL+IN  K
Sbjct: 319 SVGKGEN--GIRWKFTSKLDDLDFADDIALLSSTKHHIQEKTARLDGEARRAGLKINLEK 376

Query: 354 TVDMRVMSK 328
           T  +R+ +K
Sbjct: 377 TKMLRINAK 385



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/88 (29%), Positives = 50/88 (56%), Gaps = 1/88 (1%)
 Frame = -1

Query: 776 FLRLLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQ-VLGAPIE 600
           ++  + FEK+  +++  +     +++ G+P KII I++ L+     R V DQ   G    
Sbjct: 235 YVNFIDFEKAFDSVHRES-LWVIMEKYGVPEKIIRIVR-LFCEDFQRAVEDQGETGEWFN 292

Query: 599 MTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           +  GVKQGC +S  +F++++D ++R  V
Sbjct: 293 IKMGVKQGCNMSGFMFLLVMDWVLRRSV 320


>SB_49758| Best HMM Match : Sod_Fe_N (HMM E-Value=8.9)
          Length = 146

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWSENI-LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G G+N  GI W     L+DLD+ADDI L++ T   +Q K   L   A + GL+IN  K
Sbjct: 8   SVGKGEN--GIRWKFTYKLDDLDFADDIALLSSTKHHIQEKTAKLDGEARRAGLKINLEK 65

Query: 354 TVDMRVMSK 328
           T  +R+ +K
Sbjct: 66  TKMLRINAK 74


>SB_37101| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G G+N  GI W   + L+DLD+ADDI L++ T   +Q K   L   A + GL+IN  K
Sbjct: 24  SVGKGEN--GIRWKFTSKLDDLDFADDIALLSSTKHHIQEKTARLDGEARRAGLKINLEK 81

Query: 354 TVDMRVMSK 328
           T  +R+ +K
Sbjct: 82  TKMLRINAK 90


>SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83)
          Length = 226

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/57 (38%), Positives = 32/57 (56%)
 Frame = -3

Query: 174 VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           VWE+  +T   K+T++ + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 8   VWENKKLTISTKITVYRACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 64


>SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83)
          Length = 223

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/57 (38%), Positives = 32/57 (56%)
 Frame = -3

Query: 174 VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           VWE+  +T   K+T++ + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 8   VWENKKLTISTKITVYRACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 64


>SB_13854| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 398

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G G+N  GI W   + L+DLD+ADDI L++ T   +Q K   L   A   GL+IN  K
Sbjct: 74  SVGKGEN--GIRWKFTSKLDDLDFADDIALLSSTKHHIQEKTAKLDGEARGAGLKINLEK 131

Query: 354 TVDMRVMSK 328
           T  +R+ +K
Sbjct: 132 TKMLRINAK 140



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/52 (36%), Positives = 27/52 (51%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           +++ G+P KII I++  Y    C V      G    +  GVKQGC +S L F
Sbjct: 14  MEKYGVPEKIIRIVRLFYEDFQCAVEDQGETGEWFNIKTGVKQGCNMSGLCF 65


>SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07)
          Length = 754

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/57 (38%), Positives = 32/57 (56%)
 Frame = -3

Query: 174 VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           VWE+  +T   K+T++ + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 8   VWENKKLTISTKITVYRACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 64


>SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1)
          Length = 92

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/57 (38%), Positives = 32/57 (56%)
 Frame = -3

Query: 174 VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           VWE+  +T   K+T++ + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 8   VWENKKLTISTKITVYRACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 64


>SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42)
          Length = 226

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/57 (38%), Positives = 32/57 (56%)
 Frame = -3

Query: 174 VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           VWE+  +T   K+T++ + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 8   VWENKKLTISTKITVYRACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 64


>SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 406

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/57 (38%), Positives = 32/57 (56%)
 Frame = -3

Query: 174 VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           VWE+  +T   K+T++ + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 8   VWENKKLTISTKITVYRACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 64


>SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 226

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/57 (38%), Positives = 32/57 (56%)
 Frame = -3

Query: 174 VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           VWE+  +T   K+T++ + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 8   VWENKKLTISTKITVYRACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 64


>SB_42513| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12)
          Length = 519

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 21/48 (43%), Positives = 30/48 (62%)
 Frame = -1

Query: 677 IGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDD 534
           + ++Q +Y   T RV ++  +  P E T GVKQGC+LSP LF + L D
Sbjct: 298 LAVLQDMYSKDTARVKNNNEISEPFECTVGVKQGCILSPTLFNIFLHD 345



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 6/139 (4%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK--- 310
           L  L YADD+VL + +   +Q KL+ L     +  L I+T KT  + + +KN   L    
Sbjct: 365 LNCLLYADDLVLFSTSEKGLQRKLDILDSFCRENDLEISTEKT-KLIIFNKNGKKLSRYG 423

Query: 309 --LQDCGFEVST-EVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIK 139
             ++    E+ T   Y+   L +N   +    E++    +   +  + + ++      + 
Sbjct: 424 LTVKGQSIEIVTVNKYLGLTLSANGRYNTAKQELKNSALKALLSLKRYLGKNFCSDISLT 483

Query: 138 LTLFDSIVKSVLLFGCETW 82
           + LFDS VK  LL+G E W
Sbjct: 484 IRLFDSFVKPALLYGSELW 502


>SB_18811| Best HMM Match : RVT_1 (HMM E-Value=0.075)
          Length = 203

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 22/64 (34%), Positives = 37/64 (57%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +++ G+P KII I++  Y    C V     +G    +  GVKQGC +S  +F++++D I+
Sbjct: 46  MEKYGVPEKIIRIVKLFYEDFQCAVEDQGEIGEWFNIKTGVKQGCNMSGFMFLLVMDWIL 105

Query: 527 REVV 516
           R  V
Sbjct: 106 RRSV 109



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G G+N  GI W   + L+DLD+A+DI L++ T   +Q K   L   A + GL+IN  K
Sbjct: 108 SVGKGEN--GIRWKFTSKLDDLDFANDIALLSSTKHHIQEKTAKLDGEARRAGLKINLEK 165

Query: 354 TVDMRVMSK 328
           T  +R+ +K
Sbjct: 166 TKMLRINAK 174


>SB_8257| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 710

 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = -3

Query: 378 GLRINTNKTVDMRVMSKNTTPLKLQDC-GFEVSTEVYISGELLSNQGGSDEDIEIRIRKA 202
           GL I+ +KT  ++V  KN  P+KLQ+    + + +    G  +S  GG+D+DI+ RI K 
Sbjct: 73  GLNISQSKTRVLKVNCKNPEPIKLQNGQDIKETNDFTYLGACVSTDGGADKDIDTRISKT 132

Query: 201 RGAFAQLK 178
           + AF +LK
Sbjct: 133 KAAFRKLK 140


>SB_8056| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 22/64 (34%), Positives = 36/64 (56%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +++ G+P KII I++  Y    C V      G    +  GVKQGC +S  +F++++D I+
Sbjct: 18  MEKYGVPEKIIRIVRLFYEDFQCEVEDQGETGEWFNIKTGVKQGCNMSGFMFLLVMDWIL 77

Query: 527 REVV 516
           R  V
Sbjct: 78  RRSV 81



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 1/32 (3%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMT 439
           + G G+N  GI W   + L+DLD+ADDI L++
Sbjct: 80  SVGKGEN--GIRWKFTSKLDDLDFADDIALLS 109


>SB_46731| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11)
          Length = 519

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 24/84 (28%), Positives = 47/84 (55%)
 Frame = -1

Query: 776 FLRLLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEM 597
           ++  + FEK+  +++  +     +++ G+P KII I++  Y    C V      G  + +
Sbjct: 357 YVNFIDFEKAFNSVHRES-LWVIMEKYGVPEKIICIVRLFYEDFQCAVEDQGETGEWLNI 415

Query: 596 TAGVKQGCLLSPLLFIMLLDDIMR 525
             GVKQGC +S  +F++++D I+R
Sbjct: 416 KMGVKQGCNMSGFMFLLVMDWILR 439



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWS-ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNK 355
           + G+G+N  GI W   + L+DLD+ADDI L++ T   +Q K   L   A +   +IN  K
Sbjct: 441 SVGNGEN--GIRWKFTSKLDDLDFADDIALLSLTKRHIQEKTARLDGEARRAEFKINLEK 498

Query: 354 TVDMRVMSK 328
           T  +R+ +K
Sbjct: 499 TKMLRINAK 507


>SB_38529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 88

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 22/49 (44%), Positives = 32/49 (65%)
 Frame = -1

Query: 683 KIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
           K + +I  +Y G   +V+H+  +    EM  GV+QGCLLSPLLF++ LD
Sbjct: 23  KTVKMILVIYDGFQEKVLHEGKMSEAFEMQTGVRQGCLLSPLLFLIELD 71


>SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 342

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 21/57 (36%), Positives = 32/57 (56%)
 Frame = -3

Query: 174 VWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +WE+  +T   K+T++ + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 124 MWENKKLTISTKITVYRACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 180


>SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21)
          Length = 1080

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 22/63 (34%), Positives = 38/63 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           GI  + +  I++     T RVV D V   P+++T+GV QG +L PL+F++ ++D+   + 
Sbjct: 606 GIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDMQENLE 665

Query: 515 TTL 507
            TL
Sbjct: 666 CTL 668


>SB_40625| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 152

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 22/64 (34%), Positives = 36/64 (56%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +++ G+P KII I++  Y    C V      G    +  GVKQGC +S  +F++++D I+
Sbjct: 1   MEKYGVPEKIIRIVRLFYEDFQCAVEDQGETGEWFNIKTGVKQGCNMSGFMFLLVMDWIL 60

Query: 527 REVV 516
           R  V
Sbjct: 61  RRSV 64



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = -3

Query: 507 RGIEWSEN-ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMS 331
           R +   EN IL+DLD+ADDI L++ T   +Q K   L   A + GL+ N  KT  +R+ +
Sbjct: 62  RSVGKGENGILDDLDFADDIALLSSTKHHIQEKTARLDGEARRAGLKKNLEKTKMLRINA 121

Query: 330 KNTTPLKLQDCGFEVSTEVYISGELLSNQG 241
           K    + +     E  +E+   G  +  +G
Sbjct: 122 KQHGNIVINGKEIEDVSEIIYLGAKVCREG 151


>SB_37650| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 335

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P + I I++  + G   RV+ D    AP +++ GVKQGC+L+P LF ++   ++ +
Sbjct: 165 GCPERFIKIVRQFHDGMMARVLDDGNTSAPFQVSNGVKQGCVLAPTLFSLMFSAMLTD 222


>SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40)
          Length = 325

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 22/63 (34%), Positives = 38/63 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           GI  + +  I++     T RVV D V   P+++T+GV QG +L PL+F++ ++D+   + 
Sbjct: 207 GIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDMQENLE 266

Query: 515 TTL 507
            TL
Sbjct: 267 CTL 269


>SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3)
          Length = 242

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 22/63 (34%), Positives = 38/63 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           GI  + +  I++     T RVV D V   P+++T+GV QG +L PL+F++ ++D+   + 
Sbjct: 26  GIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDMQENLE 85

Query: 515 TTL 507
            TL
Sbjct: 86  CTL 88


>SB_16148| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 203

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P + I I++  + G   RV+ D    AP +++ GVKQGC+L+P LF ++   ++ +
Sbjct: 5   GCPERFIKIVRQFHDGMMARVLDDGNTSAPFQVSNGVKQGCVLAPTLFSLMFSAMLTD 62


>SB_13918| Best HMM Match : RVT_1 (HMM E-Value=5.2e-07)
          Length = 278

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P + I I++  + G   RV+ D    AP +++ GVKQGC+L+P LF ++   ++ +
Sbjct: 80  GCPERFIKIVRQFHDGMMARVLDDGNTSAPFQVSNGVKQGCVLAPTLFSLMFSAMLTD 137


>SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33)
          Length = 363

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 22/63 (34%), Positives = 38/63 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           GI  + +  I++     T RVV D V   P+++T+GV QG +L PL+F++ ++D+   + 
Sbjct: 147 GIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDMQENLE 206

Query: 515 TTL 507
            TL
Sbjct: 207 CTL 209


>SB_51607| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMRE 522
           G P + I I++  + G   RV+ D    AP +++ GVKQGC+L+P LF ++   ++ +
Sbjct: 61  GCPERFIKIVRQFHDGMMARVLDDGNTSAPFQVSNGVKQGCVLAPTLFSLMFSAMLTD 118


>SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 423

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 22/63 (34%), Positives = 38/63 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           GI  + +  I++     T RVV D V   P+++T+GV QG +L PL+F++ ++D+   + 
Sbjct: 207 GIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDMQENLE 266

Query: 515 TTL 507
            TL
Sbjct: 267 CTL 269


>SB_21468| Best HMM Match : RVT_1 (HMM E-Value=1.2)
          Length = 368

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 22/64 (34%), Positives = 36/64 (56%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +++ G+P KII I++  Y    C V      G    +  GVKQGC +S  +F++++D I+
Sbjct: 282 MEKYGVPEKIIRIVRLFYEDFQCAVEDQGETGEWFNIKTGVKQGCNMSGFMFLLVMDWIL 341

Query: 527 REVV 516
           R  V
Sbjct: 342 RRSV 345


>SB_6135| Best HMM Match : CSD (HMM E-Value=5.4)
          Length = 254

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 28/80 (35%), Positives = 41/80 (51%)
 Frame = -3

Query: 243 GGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTL 64
           GG D + E  + +  G  +  K VW    ++   KL ++ +IV + LL+ CETW V +  
Sbjct: 32  GGMDRE-ETGVNEKVGRLS--KTVWNRRGISTETKLGVYRAIVLTSLLYACETWTVYQRH 88

Query: 63  TNRLQVFVNKCLRSILRIFW 4
             +L  F   CLR IL I W
Sbjct: 89  ARKLNHFHTICLRKILGIKW 108


>SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16)
          Length = 287

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 22/63 (34%), Positives = 38/63 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           GI  + +  I++     T RVV D V   P+++T+GV QG +L PL+F++ ++D+   + 
Sbjct: 71  GIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDMQENLE 130

Query: 515 TTL 507
            TL
Sbjct: 131 CTL 133


>SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 393

 Score = 48.0 bits (109), Expect = 9e-06
 Identities = 22/63 (34%), Positives = 38/63 (60%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           GI  + +  I++     T RVV D V   P+++T+GV QG +L PL+F++ ++D+   + 
Sbjct: 207 GIRGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPLMFLLFINDMQENLE 266

Query: 515 TTL 507
            TL
Sbjct: 267 CTL 269


>SB_59080| Best HMM Match : RVT_1 (HMM E-Value=1.2e-35)
          Length = 318

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 4/63 (6%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSP----LLFIMLLDDIM 528
           G P + I I++  + G   RV+ +    AP +++ GVKQGC+L+P    L+F  +L D  
Sbjct: 120 GCPERFIKIVRQFHDGMMARVLDNGNTSAPFQVSNGVKQGCVLAPTLFSLMFSAMLTDAF 179

Query: 527 REV 519
           RE+
Sbjct: 180 REI 182


>SB_51188| Best HMM Match : RVT_1 (HMM E-Value=4.5e-24)
          Length = 505

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 41/140 (29%), Positives = 66/140 (47%), Gaps = 7/140 (5%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSKNTT 319
           L  L YADD+VL + T   +Q  L  L I +E+  L++NT+KT  M      +VM+    
Sbjct: 150 LNCLLYADDLVLFSETSSGLQDLLNRLSIYSEENSLKVNTSKTKVMIFNNIGKVMNNYQF 209

Query: 318 PLKLQDCGFEVSTEVYISGELLSNQGGSD-EDIEIRIRKARGAFAQLKPVWESSVMTRRI 142
            L  +     V +  Y+ G + S  G  +    E++    +  F   K +         +
Sbjct: 210 LLNREQLE-NVKSYKYL-GLVFSAVGNFNLAKEELKKTALKALFKLRKDLGIHFRSDINL 267

Query: 141 KLTLFDSIVKSVLLFGCETW 82
            L LFD+++K +LL+G E W
Sbjct: 268 TLKLFDALIKPILLYGSEVW 287



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGS-TCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           ++Q GI      +++++Y    +C  + D +         GVKQGC+LSP LF + L D+
Sbjct: 74  IQQSGISGNFYEVLRSMYSNDISCGKIGDSI-SESFRCMVGVKQGCMLSPTLFNLFLSDL 132


>SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1141

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 41/140 (29%), Positives = 66/140 (47%), Gaps = 7/140 (5%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSKNTT 319
           L  L YADD+VL + T   +Q  L  L I +E+  L++NT+KT  M      +VM+    
Sbjct: 499 LNCLLYADDLVLFSETSSGLQDLLNRLSIYSEENSLKVNTSKTKVMIFNNIGKVMNNYQF 558

Query: 318 PLKLQDCGFEVSTEVYISGELLSNQGGSD-EDIEIRIRKARGAFAQLKPVWESSVMTRRI 142
            L  +     V +  Y+ G + S  G  +    E++    +  F   K +         +
Sbjct: 559 LLNREQLE-NVKSYKYL-GLVFSAVGNFNLAKEELKKTALKALFKLRKDLGIHFRSDINL 616

Query: 141 KLTLFDSIVKSVLLFGCETW 82
            L LFD+++K +LL+G E W
Sbjct: 617 TLKLFDALIKPILLYGSEVW 636



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGS-TCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           ++Q GI      +++++Y    +C  + D +         GVKQGC+LSP LF + L D+
Sbjct: 423 IQQAGISGNFYEVLRSMYSNDISCGKIGDSI-SESFRCMVGVKQGCMLSPTLFNLFLSDL 481


>SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 989

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 26/64 (40%), Positives = 34/64 (53%), Gaps = 3/64 (4%)
 Frame = -1

Query: 677 IGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI---MREVVTTL 507
           IG+   +Y   T RV ++  +  P E T GVKQGC+LSP LF + L D      EV T  
Sbjct: 330 IGVTD-MYSKDTARVKNNNEISEPFECTVGVKQGCILSPTLFNIFLHDFALSQNEVTTDA 388

Query: 506 GALN 495
             +N
Sbjct: 389 TRIN 392



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 6/139 (4%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK--- 310
           L  L YADD+VL + +   +Q KL+ L     +  L I+T KT  + + +KN   L    
Sbjct: 396 LNCLLYADDLVLFSTSEKGLQRKLDILNCFCRENDLEISTEKT-KLIIFNKNGKKLSRYG 454

Query: 309 --LQDCGFEVST-EVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIK 139
             ++    E+ T   Y+   L +N   +    E++    +   +  + + ++      + 
Sbjct: 455 LTVKGQSIEIVTVNKYLGLTLSANGRYNTAKQELKNSALKALLSLKRNIGKNFCSDMSLT 514

Query: 138 LTLFDSIVKSVLLFGCETW 82
           + LFDS VK  LL+G E W
Sbjct: 515 IRLFDSFVKPALLYGSELW 533



 Score = 29.5 bits (63), Expect = 3.5
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = -3

Query: 288  VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKS 109
            V+   Y+   L +N   +    E++    +  F+  + + E+      + + LFDS +K 
Sbjct: 854  VTVYKYLGLTLSANGRYNTAKQELKNSALKALFSLRRNLGENFCSDISLTIRLFDSFMKP 913

Query: 108  VLLFGCETW 82
             LL+G E W
Sbjct: 914  ALLYGSELW 922


>SB_28083| Best HMM Match : Uso1_p115_C (HMM E-Value=5.7)
          Length = 307

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 20/61 (32%), Positives = 35/61 (57%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +++ G+P KII I++  Y    C V      G    +  G+KQGC +S  +F++++D I+
Sbjct: 237 MEKYGVPEKIIRIVRLFYEDFQCAVEDPGETGEWFNIKMGIKQGCNMSGFMFLLVMDWIL 296

Query: 527 R 525
           R
Sbjct: 297 R 297


>SB_21043| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 242

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = -3

Query: 264 GELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCE 88
           G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++  +  +LL+G E
Sbjct: 31  GSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSE 90

Query: 87  TWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           TW V +     L+    + LR IL+I W
Sbjct: 91  TWTVYQHEVRELRTLQQRHLRLILKIKW 118


>SB_34098| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 388

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 33/122 (27%), Positives = 58/122 (47%), Gaps = 1/122 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   NT    +  
Sbjct: 269 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNTADFYVDG 326

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFD 124
                 T     G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +  
Sbjct: 327 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVII 386

Query: 123 SI 118
           ++
Sbjct: 387 NV 388



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 170 LGKLGCPPKFISIIKKLYSDVYARLIVDGELTRAFEYNCGVKQGCKLAPTLF 221


>SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 226

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = -3

Query: 264 GELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCE 88
           G +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++  +  +LL+G E
Sbjct: 15  GSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSE 74

Query: 87  TWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           TW V +     L+    + LR IL+I W
Sbjct: 75  TWTVYQHEVRELRTLQQRHLRLILKIKW 102


>SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37)
          Length = 458

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 49/163 (30%), Positives = 79/163 (48%), Gaps = 8/163 (4%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSKNTT 319
           L  L YADD+VL + T   +Q  L  L I +E+  L++NT KT  M      +VM+    
Sbjct: 272 LNCLLYADDLVLFSETSSGLQDLLNRLSIYSEENSLKVNTLKTKVMIFNNIGKVMNNYQF 331

Query: 318 PLKLQDCGFEVSTEVYISGELLSNQGGSD-EDIEIRIRKARGAFAQLKPVWESSVMTRRI 142
            L  +     V +  Y+ G + S  G  +    E++    +  F   K +         +
Sbjct: 332 LLNREQLE-NVKSYKYL-GLVFSAVGNFNLAKEELKKTALKALFKLRKDLGIHFRSDINL 389

Query: 141 KLTLFDSIVKSVLLFGCETWRVTKTLTNRLQV-FVNKCLRSIL 16
            L LFD+++K +LL+G E W    +L N  +V +V+K L++IL
Sbjct: 390 TLKLFDALIKPILLYGSEVW---DSLENNSKVTWVHK-LKNIL 428



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGS-TCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           ++Q GI      +++++Y    +C  + D +         GVKQGC+LSP LF + L D+
Sbjct: 196 IQQAGISGNFYEVLRSMYSNDISCGKIGDSI-SESFRCMVGVKQGCMLSPTLFNLFLSDL 254


>SB_16378| Best HMM Match : DCX (HMM E-Value=0.7)
          Length = 754

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -3

Query: 264 GELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCE 88
           G  LS     D+++  RI KA  +F +L K VW    ++   KL ++ +IV + LL+ CE
Sbjct: 145 GSTLSRVIHIDDEVNARIAKASASFGRLSKTVWNRRGISTETKLGVYRAIVLTSLLYACE 204

Query: 87  TWRV 76
           TW +
Sbjct: 205 TWTI 208


>SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1858

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 41/140 (29%), Positives = 65/140 (46%), Gaps = 7/140 (5%)
 Frame = -3

Query: 480  LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSKNTT 319
            L  L YADD+VL + T   +Q  L  L I +E+  L++NT KT  M      +VM+    
Sbjct: 1516 LNCLLYADDLVLFSETSSGLQDLLNRLSIYSEENSLKVNTLKTKVMIFNNIGKVMNNYQF 1575

Query: 318  PLKLQDCGFEVSTEVYISGELLSNQGGSD-EDIEIRIRKARGAFAQLKPVWESSVMTRRI 142
             L  +     V +  Y+ G + S  G  +    E++    +  F   K +         +
Sbjct: 1576 LLNREQLE-NVKSYKYL-GLVFSAVGNFNLAKEELKKTALKALFKLRKDLGIHFRSDINL 1633

Query: 141  KLTLFDSIVKSVLLFGCETW 82
             L LFD+++K +LL+G E W
Sbjct: 1634 TLKLFDALIKPILLYGSEVW 1653



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGS-TCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
            ++Q GI      +++++Y    +C  + D +         GVKQGC+LSP LF + L D+
Sbjct: 1440 IQQSGISGNFYEVLRSMYSNDISCGKIGDSI-SESFRCMVGVKQGCMLSPTLFNLFLSDL 1498


>SB_50593| Best HMM Match : KIX (HMM E-Value=8)
          Length = 139

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 24/65 (36%), Positives = 33/65 (50%)
 Frame = -1

Query: 725 AKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIM 546
           AK    LK  G+  + + IIQ++Y      V  +  L       AGVKQGC++SP LF  
Sbjct: 30  AKLFEKLKAVGVTGRFLDIIQSMYSNDKSSVKIESSLTESFRCYAGVKQGCMISPTLFNF 89

Query: 545 LLDDI 531
            L D+
Sbjct: 90  YLSDL 94


>SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 22/63 (34%), Positives = 37/63 (58%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           GI  + +  I++     T RVV D V   P+++T+GV QG  L PL+F++ ++D+   + 
Sbjct: 85  GIQGRTLAWIKSWLTNRTERVVVDGVSLKPVDVTSGVPQGTALGPLMFLLFINDMQENLE 144

Query: 515 TTL 507
            TL
Sbjct: 145 CTL 147


>SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40)
          Length = 414

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 23/65 (35%), Positives = 32/65 (49%)
 Frame = -1

Query: 725 AKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIM 546
           AK    LK  G+  + + IIQ++Y      V     +       AGVKQGC++SP LF  
Sbjct: 109 AKLSEKLKAVGVTGRFLDIIQSMYSNDKSSVKIGSSITESFRFYAGVKQGCMISPTLFNF 168

Query: 545 LLDDI 531
            L D+
Sbjct: 169 YLSDL 173



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 32/136 (23%), Positives = 58/136 (42%), Gaps = 8/136 (5%)
 Frame = -3

Query: 465 YADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGF-- 292
           YADD+V+++ +   +Q  L  L    +   L IN +KT   +VM  N T   + +     
Sbjct: 197 YADDLVILSKSAKGLQEYLNSLEEYCKASELSINLDKT---KVMIFNNTGKTINNYRIFY 253

Query: 291 ------EVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTL 130
                  V +  Y+          +    E++    +  F   K + E      ++ L L
Sbjct: 254 GTYKIENVKSYKYLGLHFCPYGNFNLAKEELKKVALKAMFKLRKEMGEHFRQDIKLTLRL 313

Query: 129 FDSIVKSVLLFGCETW 82
           FD++++ +LL+G E W
Sbjct: 314 FDTLIQPILLYGSEIW 329


>SB_28491| Best HMM Match : RVT_1 (HMM E-Value=0.00037)
          Length = 214

 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 20/63 (31%), Positives = 37/63 (58%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +++ G+P   +  IQA+Y  ++ RV     L    ++  GV QG +LSP LFI++L+ + 
Sbjct: 55  MRRLGLPEWFVSTIQAMYSHASSRVCVSNSLSDSFKVKVGVHQGSVLSPFLFIVVLEALF 114

Query: 527 REV 519
            ++
Sbjct: 115 ADL 117



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/41 (43%), Positives = 28/41 (68%)
 Frame = -3

Query: 474 DLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT 352
           +L YADD+V+ + +LD + AKL   +   E +GLR+N +KT
Sbjct: 124 ELLYADDLVISSDSLDTLLAKLCMWKQGLESKGLRVNMSKT 164


>SB_20057| Best HMM Match : RVT_1 (HMM E-Value=3e-13)
          Length = 269

 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 21/63 (33%), Positives = 37/63 (58%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVV 516
           GI  + +  I++     T RVV D V   P+++T+ V QG +L PL+F++ ++D+   + 
Sbjct: 71  GIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSVVPQGTVLGPLMFLLFINDMQENLE 130

Query: 515 TTL 507
            TL
Sbjct: 131 CTL 133


>SB_5580| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = -3

Query: 534 HNAGSGDNTRGIEWSENI-LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGL 373
           H   S  NT  I W  N  LEDLD+ADDI L++    QMQ K + L  +A+K GL
Sbjct: 2   HETTSQGNTE-IRWKFNAQLEDLDFADDIALISTNHSQMQKKTDKLSETAQKVGL 55


>SB_55435| Best HMM Match : RVT_1 (HMM E-Value=7.9e-22)
          Length = 726

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 7/140 (5%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDM------RVMSKNTT 319
           L  L YAD +VL + T   +Q  L  L I +E+  L++NT+KT  M      +VM+    
Sbjct: 564 LNCLLYADGLVLFSETSSGLQDLLNRLSIYSEENSLKVNTSKTKVMVFNNIGKVMNNYQF 623

Query: 318 PLKLQDCGFEVSTEVYISGELLSNQGGSD-EDIEIRIRKARGAFAQLKPVWESSVMTRRI 142
            L  +     V +  Y+ G + S  G  +    E++    +  F   K +         +
Sbjct: 624 LLNREQLE-NVKSYKYL-GLVFSAVGNFNLAKEELKKTALKALFKLRKDLGIHFRSDINL 681

Query: 141 KLTLFDSIVKSVLLFGCETW 82
            L LFD+++K +LL+G E W
Sbjct: 682 TLKLFDALIKPILLYGSEVW 701



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGS-TCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           ++Q GI      +++++Y    +C  + D +    +    GVKQGC+LSP LF + L D+
Sbjct: 488 IQQAGISGNFYEVLRSMYSNDISCGKIGDSI-SESLRCMVGVKQGCMLSPTLFNLFLSDL 546


>SB_13612| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 24/65 (36%), Positives = 32/65 (49%)
 Frame = -1

Query: 725 AKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIM 546
           AK    LK  G P + + IIQ++Y      +     L       AGVKQGC++SP LF  
Sbjct: 2   AKLFEKLKAVGGPGRFLDIIQSMYSNDKSSIKIGSSLTESFRCYAGVKQGCMISPTLFNF 61

Query: 545 LLDDI 531
            L D+
Sbjct: 62  YLSDL 66



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = -3

Query: 465 YADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTT 319
           YADD+V+++ +   +Q  L  L    +  GL IN +KT   +VM  N T
Sbjct: 90  YADDLVILSKSAKGLQEYLNSLEEYCKASGLSINLDKT---KVMIFNNT 135


>SB_21258| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 461

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 24/65 (36%), Positives = 32/65 (49%)
 Frame = -1

Query: 725 AKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIM 546
           AK    LK  G P + + IIQ++Y      +     L       AGVKQGC++SP LF  
Sbjct: 86  AKLFEKLKAVGGPGRFLDIIQSMYSNDKSSIKIGSSLTESFRCYAGVKQGCMISPTLFNF 145

Query: 545 LLDDI 531
            L D+
Sbjct: 146 YLSDL 150



 Score = 35.9 bits (79), Expect = 0.041
 Identities = 38/137 (27%), Positives = 63/137 (45%), Gaps = 9/137 (6%)
 Frame = -3

Query: 465 YADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGFEV 286
           YADD+V+++ +   +Q  L  L    +   L IN +KT   +VM  N T   + +     
Sbjct: 174 YADDLVILSKSAKGLQEYLNSLEKYCKASELSINLDKT---KVMIFNNTGKTMNNYRIFY 230

Query: 285 STEVYISGELLSNQG------GSDEDIEIRIRK-ARGAFAQLKPVWESSVMTRRIKLTL- 130
            T    + +     G      G+    +  ++K A  A  +LK   E     + IKLTL 
Sbjct: 231 GTYKIENVKSYKYLGLHFCPYGNFNLAKEELKKVALKAIFKLKKEMERH-FRQNIKLTLR 289

Query: 129 -FDSIVKSVLLFGCETW 82
            FD++++ +LL+G E W
Sbjct: 290 LFDTLIQPILLYGSEIW 306


>SB_19895| Best HMM Match : PHD (HMM E-Value=3.8e-08)
          Length = 335

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 20/63 (31%), Positives = 37/63 (58%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +++ G+P   +  IQA+Y  ++ RV     L    ++  GV QG +LSP LFI++L+ + 
Sbjct: 1   MRRLGLPEWFVSTIQAMYSHASSRVCVSNSLSDSFKVKVGVHQGSVLSPFLFIVVLEALS 60

Query: 527 REV 519
            ++
Sbjct: 61  ADL 63



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 22/72 (30%), Positives = 35/72 (48%)
 Frame = -3

Query: 264 GELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCET 85
           G+ +   GG +  I  R R A G F +L PV  S  ++   +  ++ S V+S +L+  E 
Sbjct: 205 GDTICAGGGCEAAIITRTRSAWGKFKELLPVLSSKSLSLCTRGKVYSSCVRSAMLYAGEC 264

Query: 84  WRVTKTLTNRLQ 49
           W    +   RLQ
Sbjct: 265 WAPKSSDLTRLQ 276



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/41 (43%), Positives = 28/41 (68%)
 Frame = -3

Query: 474 DLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT 352
           +L YADD+V+ + +LD + AKL   +   E +GLR+N +KT
Sbjct: 70  ELLYADDLVISSDSLDTLLAKLCMWKQGLESKGLRVNMSKT 110


>SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 788

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 28/100 (28%), Positives = 49/100 (49%)
 Frame = -1

Query: 767 LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
           +L F K+     S AK    L   GI  K +G I+A        VV D    + + +T+G
Sbjct: 244 MLDFSKA-FDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSG 302

Query: 587 VKQGCLLSPLLFIMLLDDIMREVVTTLGALNGAKISWKTL 468
           V QG +L P LF++ ++DI+ +  + +       + ++T+
Sbjct: 303 VPQGTVLGPTLFLVFINDIVDQCSSVIRLFADDTVVYRTI 342


>SB_29799| Best HMM Match : RVT_1 (HMM E-Value=3e-35)
          Length = 360

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 183 LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 234


>SB_6031| Best HMM Match : RVT_1 (HMM E-Value=3.4)
          Length = 378

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I II+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 298 LGKLGCPPKFISIIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 349


>SB_54945| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 392

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = -3

Query: 258 LLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETW 82
           +LS+      ++  RI+    A+ +L K V++S  +T   K+ +++  +  +LL+G ETW
Sbjct: 197 ILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETW 256

Query: 81  RVTKTLTNRLQVFVNKCLRSILRIFW 4
            V +     L+    + LR IL+I W
Sbjct: 257 TVYQHEVRELRTLQQRHLRLILKIKW 282


>SB_46891| Best HMM Match : RVT_1 (HMM E-Value=1.6e-05)
          Length = 235

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/65 (35%), Positives = 32/65 (49%)
 Frame = -1

Query: 725 AKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIM 546
           AK    LK  G+  + + IIQ++Y      V     +       AGVKQGC++SP LF  
Sbjct: 109 AKLFEKLKAVGVTGRFLDIIQSMYSNDKSSVKIGSSITESFRCYAGVKQGCMISPTLFNF 168

Query: 545 LLDDI 531
            L D+
Sbjct: 169 YLSDL 173


>SB_41944| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 698

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/65 (35%), Positives = 32/65 (49%)
 Frame = -1

Query: 725 AKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIM 546
           AK    LK  G+  + + IIQ++Y      V     +       AGVKQGC++SP LF  
Sbjct: 9   AKLFEKLKAVGVTGRFLDIIQSMYSNDKSSVKIGSSITESFRCYAGVKQGCMISPTLFNF 68

Query: 545 LLDDI 531
            L D+
Sbjct: 69  YLSDL 73



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = -3

Query: 285 STEVYI-SGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKS 109
           S E Y  + EL  N   + E+++    KA   F   K + E      ++ L LFD++++ 
Sbjct: 117 SLEEYCKASELSINLDKTKEELKKVALKAM--FKLRKEMGEHFRQDIKLTLRLFDTLIQP 174

Query: 108 VLLFGCETW 82
           +LL+G E W
Sbjct: 175 ILLYGSEIW 183


>SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 411

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 27/80 (33%), Positives = 41/80 (51%)
 Frame = -1

Query: 767 LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
           +L F K+     S AK    L   GI  K +G I+A        VV D    + + +T+G
Sbjct: 142 MLDFSKA-FDKVSNAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSG 200

Query: 587 VKQGCLLSPLLFIMLLDDIM 528
           V QG +L P LF++ ++DI+
Sbjct: 201 VPQGTVLGPTLFLVFINDIV 220


>SB_21595| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 216

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/65 (35%), Positives = 32/65 (49%)
 Frame = -1

Query: 725 AKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIM 546
           AK    LK  G+  + + IIQ++Y      V     +       AGVKQGC++SP LF  
Sbjct: 30  AKLFEKLKAVGVTGRFLDIIQSMYSNDKSSVKIGSSITESFRCYAGVKQGCMISPTLFNF 89

Query: 545 LLDDI 531
            L D+
Sbjct: 90  YLSDL 94


>SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 576

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 22/52 (42%), Positives = 28/52 (53%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           L + G P K I +I+ LY     R++ D  L    E   GVKQGC L+P LF
Sbjct: 352 LGKLGCPPKFISVIKKLYSDVHARLIVDGELTRAFEYNCGVKQGCKLAPTLF 403



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 1/114 (0%)
 Frame = -3

Query: 480 LEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
           + +  YADDI L + T + +Q+ L      A++ G+RINT KT  M +   N     +  
Sbjct: 451 IREAQYADDIALFSDTPEGLQSLLTSYNELAKRMGMRINTKKTETMCI--GNNADFYVDG 508

Query: 300 CGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL-KPVWESSVMTRRI 142
                 T     G +LS+      ++  RI+    A+ +L K V++S V+   I
Sbjct: 509 IKLVNVTHFKYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSLVVIEGI 562


>SB_56322| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 290

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/65 (35%), Positives = 32/65 (49%)
 Frame = -1

Query: 725 AKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIM 546
           AK    LK  G+  + + IIQ++Y      V     +       AGVKQGC++SP LF  
Sbjct: 2   AKLFEKLKAVGVTERFLDIIQSMYSNDKSSVKIGSSITESFRCYAGVKQGCMISPTLFNF 61

Query: 545 LLDDI 531
            L D+
Sbjct: 62  YLSDL 66


>SB_53195| Best HMM Match : CaMBD (HMM E-Value=1.4)
          Length = 83

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 19/46 (41%), Positives = 30/46 (65%)
 Frame = -3

Query: 141 KLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           KL ++++IV   LL+GCETW + +    +L  F  + LR+I+RI W
Sbjct: 19  KLKVYNAIVLPSLLYGCETWTLYRRHIKKLGQFHTRSLRAIMRIRW 64


>SB_47325| Best HMM Match : RVT_1 (HMM E-Value=2.2e-31)
          Length = 300

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/65 (35%), Positives = 32/65 (49%)
 Frame = -1

Query: 725 AKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIM 546
           AK    LK  G+  + + IIQ++Y      V     +       AGVKQGC++SP LF  
Sbjct: 109 AKLFEKLKAVGVTGRFLDIIQSMYSNDKSSVKIGSSITESFRCYAGVKQGCMISPTLFNF 168

Query: 545 LLDDI 531
            L D+
Sbjct: 169 YLSDL 173


>SB_5851| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/71 (29%), Positives = 43/71 (60%), Gaps = 1/71 (1%)
 Frame = -3

Query: 276 VYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLL 100
           VY+ G  +S+    D +I  R  KA   +A+L+  +W++  ++ ++K  ++ ++V S L+
Sbjct: 5   VYL-GSTISDNARIDNEITFRKGKASATYAKLRERLWDNHHVSLKVKGKVYRAVVLSALV 63

Query: 99  FGCETWRVTKT 67
           +G ETW V ++
Sbjct: 64  YGAETWTVYRS 74


>SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22)
          Length = 1797

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 24/72 (33%), Positives = 37/72 (51%)
 Frame = -1

Query: 707  LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
            LK+ G+P  ++  +  LY  ST  + H      PI +  GVKQG  LSP +F  ++D  +
Sbjct: 1304 LKRLGVPPPLLSYVCDLYSRSTTIIQHGGRGSQPISVRQGVKQGDPLSPFIFNAVIDWAL 1363

Query: 527  REVVTTLGALNG 492
             E+   +G   G
Sbjct: 1364 AELDPLIGVKFG 1375


>SB_3959| Best HMM Match : RVT_1 (HMM E-Value=6.4e-40)
          Length = 380

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 22/67 (32%), Positives = 34/67 (50%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L + G P K   +I+ LY   T  V+ D        ++ GVKQGC+L+P+LF +    ++
Sbjct: 163 LSKLGCPAKFTTLIRLLYDDMTGEVLSDGEPSESFSISNGVKQGCVLAPVLFNLFFTQVL 222

Query: 527 REVVTTL 507
              V  L
Sbjct: 223 LHAVRDL 229



 Score = 37.1 bits (82), Expect = 0.018
 Identities = 29/109 (26%), Positives = 57/109 (52%), Gaps = 5/109 (4%)
 Frame = -3

Query: 489 ENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLK 310
           E ++ D  +ADD  LM    + +Q  ++    +++  GL+I+ +KT  +   + ++ P +
Sbjct: 257 ERLILDALFADDCALMAHQENHLQTIVDKFSEASKLFGLKISLSKTEVLLQPAPDSIPQQ 316

Query: 309 --LQDCGFE---VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLK 178
             +   G +   V + VY+ G  +SN    D++I  RI+KA  A  +L+
Sbjct: 317 PCITIDGTQLKNVDSFVYL-GSTISNDNTLDKEIAARIQKASHALGKLR 364


>SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21)
          Length = 314

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 27/80 (33%), Positives = 41/80 (51%)
 Frame = -1

Query: 767 LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
           +L F K+     S AK    L   GI  K +G I+A        VV D    + + +T+G
Sbjct: 57  MLDFSKA-FDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSG 115

Query: 587 VKQGCLLSPLLFIMLLDDIM 528
           V QG +L P LF++ ++DI+
Sbjct: 116 VPQGTVLGPTLFLVFINDIV 135


>SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 931

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 27/80 (33%), Positives = 41/80 (51%)
 Frame = -1

Query: 767 LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
           +L F K+     S AK    L   GI  K +G I+A        VV D    + + +T+G
Sbjct: 534 MLDFSKA-FDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSG 592

Query: 587 VKQGCLLSPLLFIMLLDDIM 528
           V QG +L P LF++ ++DI+
Sbjct: 593 VPQGTVLGPTLFLVFINDIV 612


>SB_53026| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 201

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 18/46 (39%), Positives = 31/46 (67%)
 Frame = -1

Query: 644 TCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVVTTL 507
           T RVV D V   P+++T+GV +G +L PL+F++ ++D+   +  TL
Sbjct: 2   TQRVVVDGVSSKPVDVTSGVPKGTVLGPLMFLLFINDMQENLECTL 47


>SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2529

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 27/80 (33%), Positives = 41/80 (51%)
 Frame = -1

Query: 767  LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
            +L F K+     S AK    L   GI  K +G I+A        VV D    + + +T+G
Sbjct: 1260 MLDFSKA-FDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSG 1318

Query: 587  VKQGCLLSPLLFIMLLDDIM 528
            V QG +L P LF++ ++DI+
Sbjct: 1319 VPQGTVLGPTLFLVFINDIV 1338


>SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2124

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 27/80 (33%), Positives = 41/80 (51%)
 Frame = -1

Query: 767  LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
            +L F K+     S AK    L   GI  K +G I+A        VV D    + + +T+G
Sbjct: 1924 MLDFSKA-FDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSG 1982

Query: 587  VKQGCLLSPLLFIMLLDDIM 528
            V QG +L P LF++ ++DI+
Sbjct: 1983 VPQGTVLGPTLFLVFINDIV 2002


>SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23)
          Length = 409

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 27/80 (33%), Positives = 41/80 (51%)
 Frame = -1

Query: 767 LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
           +L F K+     S AK    L   GI  K +G I+A        VV D    + + +T+G
Sbjct: 57  MLDFSKA-FDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSG 115

Query: 587 VKQGCLLSPLLFIMLLDDIM 528
           V QG +L P LF++ ++DI+
Sbjct: 116 VPQGTVLGPTLFLVFINDIV 135


>SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 295

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 27/80 (33%), Positives = 41/80 (51%)
 Frame = -1

Query: 767 LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
           +L F K+     S AK    L   GI  K +G I+A        VV D    + + +T+G
Sbjct: 212 MLDFSKA-FDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSG 270

Query: 587 VKQGCLLSPLLFIMLLDDIM 528
           V QG +L P LF++ ++DI+
Sbjct: 271 VPQGTVLGPTLFLVFINDIV 290


>SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 888

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 27/80 (33%), Positives = 41/80 (51%)
 Frame = -1

Query: 767 LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
           +L F K+     S AK    L   GI  K +G I+A        VV D    + + +T+G
Sbjct: 273 MLDFSKA-FDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSG 331

Query: 587 VKQGCLLSPLLFIMLLDDIM 528
           V QG +L P LF++ ++DI+
Sbjct: 332 VPQGTVLGPTLFLVFINDIV 351


>SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7)
          Length = 189

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 22/65 (33%), Positives = 32/65 (49%)
 Frame = -1

Query: 725 AKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIM 546
           AK    L+  G+  + + IIQ++Y      V     +       AGVKQGC++SP LF  
Sbjct: 109 AKLFEKLRAVGVTGRFLDIIQSMYSNDKSSVKIGSSITESFRCYAGVKQGCMISPTLFNF 168

Query: 545 LLDDI 531
            L D+
Sbjct: 169 YLSDL 173


>SB_42434| Best HMM Match : RVT_1 (HMM E-Value=2.7e-18)
          Length = 418

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 23/75 (30%), Positives = 37/75 (49%)
 Frame = -1

Query: 755 EKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQG 576
           ++++  L + AK    LK  G+  + + IIQ++Y      V     +       AGVKQG
Sbjct: 125 KQTISCLRATAKLFEKLKAVGVTGRFLDIIQSMYSNDKSSVKIGSSITESFRFYAGVKQG 184

Query: 575 CLLSPLLFIMLLDDI 531
           C++S  LF   L D+
Sbjct: 185 CMISTTLFNFYLSDL 199



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 37/137 (27%), Positives = 63/137 (45%), Gaps = 9/137 (6%)
 Frame = -3

Query: 465 YADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQDCGF-- 292
           YADD+V+++ +   +Q  L  L+   +   L IN +KT   +VM  N T   + +     
Sbjct: 223 YADDLVILSKSAKGLQEYLNSLKEYCKASELSINLDKT---KVMIFNNTGKTMNNYRIFY 279

Query: 291 ------EVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLT 133
                  V +  Y+ G      G S+   E   + A  A  +LK  + E      ++ L 
Sbjct: 280 GTYKIENVKSYKYL-GLYFCPYGNSNLAKEELKKVALNAMFKLKKEMGEHFRQDIKLTLR 338

Query: 132 LFDSIVKSVLLFGCETW 82
           LFD++++ +LL+G E W
Sbjct: 339 LFDTLIQPILLYGSEIW 355


>SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08)
          Length = 652

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 26/82 (31%), Positives = 40/82 (48%)
 Frame = -3

Query: 264 GELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTLFDSIVKSVLLFGCET 85
           G+ +   GG +  I  R R A G F +L PV  S  ++ R +  ++ S V+S +L+  E 
Sbjct: 522 GDTICAGGGCEAAIITRTRSAWGKFKELLPVLSSKSLSLRTRGKVYSSCVRSAMLYAGEC 581

Query: 84  WRVTKTLTNRLQVFVNKCLRSI 19
           W    +   RLQ   +  LR I
Sbjct: 582 WAPKSSDLARLQRSEHAMLRWI 603



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/41 (43%), Positives = 28/41 (68%)
 Frame = -3

Query: 474 DLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT 352
           +L YADD+V+ + +LD + AKL   +   E +GLR+N +KT
Sbjct: 387 ELLYADDLVISSDSLDTLLAKLCMWKQGLESKGLRVNMSKT 427


>SB_45459| Best HMM Match : RVT_1 (HMM E-Value=6e-36)
          Length = 1346

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 21/53 (39%), Positives = 31/53 (58%)
 Frame = -1

Query: 695  GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
            G+P   I  IQA+Y  ++ RV     L    ++  GV QG +LSP LFI++L+
Sbjct: 1125 GLPEWFISTIQAMYSHASSRVCVSNSLMDSFKVQVGVHQGSVLSPFLFIVVLE 1177



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 18/41 (43%), Positives = 28/41 (68%)
 Frame = -3

Query: 474  DLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT 352
            +L YADD+V+ + +LD + AKL   +   E +GLR+N +KT
Sbjct: 1190 ELLYADDLVISSDSLDTLLAKLGMWKQGLESKGLRVNMSKT 1230


>SB_37313| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 203

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = -3

Query: 228 DIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRL 52
           ++  RI+    A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L
Sbjct: 4   ELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVREL 63

Query: 51  QVFVNKCLRSILRIFW 4
           +    + LR IL+I W
Sbjct: 64  RTLQQRHLRLILKIKW 79


>SB_33707| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 368

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 23/75 (30%), Positives = 37/75 (49%)
 Frame = -1

Query: 755 EKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQG 576
           ++++  L + AK    LK  G+  + + IIQ++Y      V     +       AGVKQG
Sbjct: 125 KQTISCLRATAKLFEKLKAVGVTGRFLDIIQSMYSNDKSSVKIGSSITESFRCYAGVKQG 184

Query: 575 CLLSPLLFIMLLDDI 531
           C++S  LF   L D+
Sbjct: 185 CMISTTLFNFYLSDL 199



 Score = 28.3 bits (60), Expect = 8.1
 Identities = 14/47 (29%), Positives = 26/47 (55%)
 Frame = -3

Query: 465 YADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKN 325
           YADD+V+++ +   +Q  L  L+   +   L IN +KT   + +S +
Sbjct: 223 YADDLVILSKSAKGLQEYLNSLKEYCKASELSINLDKTKGSQSISSS 269


>SB_1380| Best HMM Match : RVT_1 (HMM E-Value=1.4e-38)
          Length = 622

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV 519
           G+P   I  I+A+Y  ++ RV     L    ++  GV QG +LSP LFI++L+ +  ++
Sbjct: 266 GLPEWFISTIKAMYSHASSRVCVSNSLNDSFKVQVGVHQGSVLSPFLFIVVLEALSADL 324



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 17/41 (41%), Positives = 27/41 (65%)
 Frame = -3

Query: 474 DLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT 352
           +L YADD+V+ + +LD + AKL   +   E +GL +N +KT
Sbjct: 331 ELLYADDLVISSDSLDTLLAKLCMWKQGLESKGLHVNMSKT 371


>SB_58038| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 201

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = -3

Query: 228 DIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRL 52
           ++  RI+    A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L
Sbjct: 2   ELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVREL 61

Query: 51  QVFVNKCLRSILRIFW 4
           +    + LR IL+I W
Sbjct: 62  RTLQQRHLRLILKIKW 77


>SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23)
          Length = 2386

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 24/68 (35%), Positives = 36/68 (52%)
 Frame = -1

Query: 731 SGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           S AK    L   GI  K +G I+A        VV D    + + +T+GV QG +L P LF
Sbjct: 151 SHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSGVPQGTVLGPTLF 210

Query: 551 IMLLDDIM 528
           ++ ++DI+
Sbjct: 211 LVFINDIV 218


>SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 822

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 21/59 (35%), Positives = 35/59 (59%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L+Q G+   ++    +   G   RVVHD V  + + +T+GV QG +L PLLF++  +D+
Sbjct: 577 LQQYGVTGSLMKWFVSYLTGRGQRVVHDGVSYSWLPVTSGVPQGSILGPLLFLVYANDM 635


>SB_23124| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 203

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = -3

Query: 228 DIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRL 52
           ++  RI+    A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L
Sbjct: 4   ELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVREL 63

Query: 51  QVFVNKCLRSILRIFW 4
           +    + LR IL+I W
Sbjct: 64  RTLQQRHLRLILKIKW 79


>SB_1327| Best HMM Match : AT_hook (HMM E-Value=3.3)
          Length = 203

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = -3

Query: 228 DIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRL 52
           ++  RI+    A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L
Sbjct: 4   ELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVREL 63

Query: 51  QVFVNKCLRSILRIFW 4
           +    + LR IL+I W
Sbjct: 64  RTLQQRHLRLILKIKW 79


>SB_21106| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 203

 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = -3

Query: 216 RIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFV 40
           RI+    A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +     L+   
Sbjct: 8   RIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVRELRTLQ 67

Query: 39  NKCLRSILRIFW 4
            + LR IL+I W
Sbjct: 68  QRHLRLILKIKW 79


>SB_52890| Best HMM Match : PH (HMM E-Value=1e-06)
          Length = 449

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = -3

Query: 144 IKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKCLRSILRIFW 4
           +++T++ + + S LL+G E+W        RL  F  +CLR IL I W
Sbjct: 50  VQITVYRACILSTLLYGSESWTTYARQEKRLNTFHMRCLRRILGIHW 96


>SB_27725| Best HMM Match : RVT_1 (HMM E-Value=1.9e-19)
          Length = 262

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/63 (30%), Positives = 36/63 (57%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           +++ G+    +  IQA+Y  ++ RV     L    ++  GV QG +LSP LFI++L+ + 
Sbjct: 120 MRRLGLSEWFVSTIQAMYSHASSRVCVSNSLSDSFKVQVGVHQGSVLSPFLFIVVLEALS 179

Query: 527 REV 519
            ++
Sbjct: 180 ADL 182



 Score = 35.1 bits (77), Expect = 0.071
 Identities = 17/41 (41%), Positives = 27/41 (65%)
 Frame = -3

Query: 474 DLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT 352
           +L YADD+V+ + +LD + AKL   +   E +GL +N +KT
Sbjct: 189 ELLYADDLVISSDSLDALLAKLCMWKQGLESKGLCVNMSKT 229


>SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 217

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/80 (32%), Positives = 40/80 (50%)
 Frame = -1

Query: 767 LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
           +L F K+     S  K    L   GI  K +G I+A        VV D    + + +T+G
Sbjct: 134 MLDFSKA-FDKVSHTKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSG 192

Query: 587 VKQGCLLSPLLFIMLLDDIM 528
           V QG +L P LF++ ++DI+
Sbjct: 193 VPQGTVLGPTLFLVFINDIV 212


>SB_47435| Best HMM Match : RVT_1 (HMM E-Value=7.8e-23)
          Length = 364

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = -1

Query: 722 KC-GPC--LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLF 552
           KC GP   + + G P+K I I++ L+ G    V  +        ++ GVKQGC+L+P LF
Sbjct: 155 KCRGPLKIMAKFGCPSKFINIVRQLHDGMLASVQDNGETSHSFPVSNGVKQGCVLAPTLF 214

Query: 551 IMLLDDIMRE 522
            ++   ++ +
Sbjct: 215 SLMFSAMLTD 224



 Score = 33.5 bits (73), Expect = 0.22
 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 5/109 (4%)
 Frame = -3

Query: 492 SENILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMR--VMSKNTT 319
           S + + DL +ADD  L   +   +Q  ++    +    GL+INT KT  M      K  T
Sbjct: 256 SADTVNDLLFADDCALNATSQADLQHSVDLFSSACNNFGLKINTKKTEAMHQPAPGKPYT 315

Query: 318 PLKLQDCGFE---VSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQL 181
              +   G +   V   +Y+ G  LS     D+++  R+ +A  AF +L
Sbjct: 316 EPNIIINGQKLNAVDKFIYL-GSTLSRNVVLDDEVTNRLARASAAFGRL 363


>SB_10602| Best HMM Match : RVT_1 (HMM E-Value=1.3e-10)
          Length = 416

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 27/108 (25%), Positives = 54/108 (50%), Gaps = 6/108 (5%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
           I+ ++ YADD  L+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++  
Sbjct: 284 IVREMLYADDSALVAHDVESMQRLVDRFSSAAEQFSLKINIKKTECLFQPVKRQTLTQFP 343

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLK 178
             + +++     + +    G  +S+    D +I  R RKA  A+A+L+
Sbjct: 344 GEIHVRNETLVQTKDFVYLGSTISDNARIDNEITFRKRKASAAYAKLR 391



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           G P K + +I++L+ G    V          +++ GVKQGC+L+P LF + L  ++
Sbjct: 192 GCPPKFVNVIRSLHSGMKASVSQGGNDSKQFDVSNGVKQGCVLAPTLFSLYLSAML 247


>SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 255

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = -3

Query: 234 DEDIEIRIRKARGAFAQL-KPVWESSVMTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTN 58
           +E   + I+    A+ +L K V++S  +T   K+ +++  +  +LL+G ETW V +    
Sbjct: 54  EELYHVLIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPLLLYGSETWTVYQHEVR 113

Query: 57  RLQVFVNKCLRSILRIFW 4
            L+    + LR IL+I W
Sbjct: 114 ELRTLQQRHLRLILKIKW 131


>SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36)
          Length = 1677

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 29/104 (27%), Positives = 47/104 (45%)
 Frame = -1

Query: 767  LLTFEKSVLTLYSGAKCGPCLKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAG 588
            LL F+K+     S +K    LK  GI  K +  + A     +  V  D      + +T+G
Sbjct: 1283 LLDFQKA-FDKVSHSKLQQKLKLYGISGKTLSWLSAFLTNRSQFVAVDGAKSNAVPVTSG 1341

Query: 587  VKQGCLLSPLLFIMLLDDIMREVVTTLGALNGAKISWKTLTMQM 456
            V QG +L P LF++ ++DI   + + +       +S   LT  M
Sbjct: 1342 VPQGTVLGPTLFLLFINDIADSLDSQMRLFADMPLSIARLTRSM 1385


>SB_40332| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 477

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 28/122 (22%), Positives = 61/122 (50%), Gaps = 7/122 (5%)
 Frame = -3

Query: 483 ILEDLDYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKT------VDMRVMSKNT 322
           I+ ++ YADD  L+   ++ MQ  ++    +AE+  L+IN  KT      V  + +++  
Sbjct: 126 IVREMLYADDSALVAHDVESMQRLVDRFSSAAEQFSLKINIKKTECLFQPVKRQTLTQFP 185

Query: 321 TPLKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRR 145
             + +++     + +    G  +S+    D +I  R  KA  A+A+L+  +W++  ++ +
Sbjct: 186 GEIHVRNETLVQTKDFVYLGSTISDNARIDNEITFRKGKASAAYAKLRERLWDNHHVSLK 245

Query: 144 IK 139
            K
Sbjct: 246 FK 247


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,886,968
Number of Sequences: 59808
Number of extensions: 621250
Number of successful extensions: 2993
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 2541
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2903
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2347493764
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).