SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0036
         (648 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_17881| Best HMM Match : Tubulin (HMM E-Value=0)                    182   2e-46
SB_47198| Best HMM Match : Tubulin (HMM E-Value=0)                    182   2e-46
SB_17879| Best HMM Match : Tubulin (HMM E-Value=0)                    180   1e-45
SB_39308| Best HMM Match : Tubulin (HMM E-Value=0)                    160   8e-40
SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27)              136   2e-32
SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.)             101   4e-22
SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.)              99   3e-21
SB_19437| Best HMM Match : Tubulin (HMM E-Value=0)                     98   5e-21
SB_2674| Best HMM Match : Tubulin (HMM E-Value=0)                      98   5e-21
SB_34400| Best HMM Match : Tubulin (HMM E-Value=0)                     97   8e-21
SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.)              97   1e-20
SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.)              96   3e-20
SB_2003| Best HMM Match : Tubulin (HMM E-Value=0)                      95   3e-20
SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.)              91   5e-19
SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)              90   1e-18
SB_48961| Best HMM Match : Tubulin (HMM E-Value=0)                     68   6e-12
SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   2e-11
SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0)                   64   1e-10
SB_35594| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_25311| Best HMM Match : Tubulin (HMM E-Value=0)                     58   6e-09
SB_5512| Best HMM Match : Tubulin (HMM E-Value=0)                      58   6e-09
SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24)                53   2e-07
SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44)           48   7e-06
SB_37976| Best HMM Match : Tubulin (HMM E-Value=4.5e-18)               42   6e-04
SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32)             41   8e-04
SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.012
SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0)                   31   1.1  
SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.1  
SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083)                    30   1.9  
SB_50693| Best HMM Match : C2 (HMM E-Value=0)                          29   2.5  
SB_47545| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.3  
SB_17458| Best HMM Match : Metalloenzyme (HMM E-Value=0.29)            29   4.3  
SB_50370| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.7  
SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.5  
SB_34911| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.5  
SB_46977| Best HMM Match : Cu_amine_oxid (HMM E-Value=3.9e-09)         27   9.9  
SB_23752| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.9  

>SB_17881| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 458

 Score =  182 bits (444), Expect = 2e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 259 RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 318

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 319 YTEGAELVDSVLDVVRKEAESCDCLQGF 346



 Score = 90.6 bits (215), Expect = 9e-19
 Identities = 40/44 (90%), Positives = 40/44 (90%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 214 MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 257



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 344 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 387


>SB_47198| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 446

 Score =  182 bits (443), Expect = 2e-46
 Identities = 81/88 (92%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 90.6 bits (215), Expect = 9e-19
 Identities = 40/44 (90%), Positives = 40/44 (90%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>SB_17879| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 446

 Score =  180 bits (437), Expect = 1e-45
 Identities = 79/88 (89%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPR+V++DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRSVLIDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELMDSVLDVVRKEAESCDCIQGF 133



 Score = 88.2 bits (209), Expect = 5e-18
 Identities = 39/44 (88%), Positives = 40/44 (90%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIV +QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVSLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFS+VPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSIVPSPK 174


>SB_39308| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 391

 Score =  160 bits (389), Expect = 8e-40
 Identities = 72/77 (93%), Positives = 74/77 (96%)
 Frame = +2

Query: 290 GKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSV 469
           GKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSV
Sbjct: 2   GKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSV 61

Query: 470 LDVVRKEAEGCDCCRVF 520
           LDVVRKEAE CDC + F
Sbjct: 62  LDVVRKEAESCDCIQGF 78



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 76  QGFQLTHSLGGGTGSGMVTLLILKIREEYPDRIMNTFSVVPSPK 119


>SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27)
          Length = 144

 Score =  136 bits (328), Expect = 2e-32
 Identities = 55/75 (73%), Positives = 67/75 (89%)
 Frame = +2

Query: 284 SGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVD 463
           +GG+YVPR+++VDLEPGTMD+VR GP G +FRPDNFV  QSGA NNWAKGHY+EGAEL+D
Sbjct: 11  TGGRYVPRSILVDLEPGTMDAVRGGPLGNMFRPDNFVNSQSGAANNWAKGHYSEGAELID 70

Query: 464 SVLDVVRKEAEGCDC 508
           ++ DV+RKEAE CDC
Sbjct: 71  NIFDVLRKEAENCDC 85



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/21 (80%), Positives = 19/21 (90%)
 Frame = +1

Query: 580 KIREEYPDRIMNTFSVVPSSK 642
           KIREEYPDRI++ FSVVPS K
Sbjct: 110 KIREEYPDRILSAFSVVPSPK 130


>SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 112

 Score =  101 bits (243), Expect = 4e-22
 Identities = 44/47 (93%), Positives = 47/47 (100%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 397
           RINVYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVF
Sbjct: 46  RINVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVF 92



 Score = 90.6 bits (215), Expect = 9e-19
 Identities = 40/44 (90%), Positives = 40/44 (90%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44


>SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 452

 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 40/80 (50%), Positives = 58/80 (72%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV  DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGSGKHVPRAVFCDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D+VLD +RK A+GC
Sbjct: 110 VGKEMIDTVLDRLRKLADGC 129



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 42


>SB_19437| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 885

 Score = 98.3 bits (234), Expect = 5e-21
 Identities = 42/80 (52%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  V G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLVTGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 VGKEIVDLVLDRIRKLADQC 129



 Score = 97.9 bits (233), Expect = 6e-21
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 483 NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 542

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 543 VGKEIVDLVLDRIRKLADQC 562



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 435 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 475


>SB_2674| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 1036

 Score = 98.3 bits (234), Expect = 5e-21
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 635 NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 694

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G EL+D VLD +RK A+ C
Sbjct: 695 VGKELIDLVLDRIRKLADQC 714



 Score = 97.5 bits (232), Expect = 8e-21
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 114 NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 173

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 174 IGKEIVDLVLDRIRKLADQC 193



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 16/43 (37%), Positives = 21/43 (48%)
 Frame = +3

Query: 120 IMREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           + RE + +  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 64  LQRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 106



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSV 349
           N +++E   GK+VPRAV VDLEP   + +
Sbjct: 562 NTFFSETGAGKHVPRAVFVDLEPTVRECI 590



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 17/42 (40%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           +RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 586 VRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 627



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 514 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 554


>SB_34400| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 380

 Score = 97.5 bits (232), Expect = 8e-21
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 49  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 108

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 109 VGKEIIDLVLDRIRKLADQC 128



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 41


>SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1231

 Score = 97.1 bits (231), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N ++ E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 421 NTFFAETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 480

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E +D VLD +RK A+GC
Sbjct: 481 VGKEQIDIVLDRLRKLADGC 500



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 39/80 (48%), Positives = 56/80 (70%)
 Frame = +2

Query: 263  NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
            N +++E   GK+VPRAV  DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 854  NTFFSETGAGKHVPRAVFADLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 913

Query: 443  EGAELVDSVLDVVRKEAEGC 502
             G E++D VLD +RK A+ C
Sbjct: 914  VGKEMIDLVLDRIRKLADQC 933



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 373 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 413



 Score = 35.1 bits (77), Expect = 0.050
 Identities = 15/41 (36%), Positives = 20/41 (48%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           RE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 806 RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 846


>SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 865

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 38/80 (47%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D +R+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 468 NTFFSETGAGKHVPRAVFVDLEPSVIDEIRTGTYRQLFHPEQLITGKEDAANNYARGHYT 527

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G + +D+VLD +RK A+ C
Sbjct: 528 VGKDHIDNVLDRIRKLADQC 547



 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 38/80 (47%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV  DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 35  NTFFSETGAGKHVPRAVFCDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 94

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G +L++ VLD +RK A+ C
Sbjct: 95  VGKQLIEIVLDRLRKLADQC 114



 Score = 35.9 bits (79), Expect = 0.028
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           RE V I  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 420 RECVSIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 460


>SB_2003| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 451

 Score = 95.5 bits (227), Expect = 3e-20
 Identities = 40/80 (50%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD  RK A+ C
Sbjct: 110 IGKEIIDLVLDRCRKLADQC 129



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 17/42 (40%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 42


>SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 417

 Score = 91.5 bits (217), Expect = 5e-19
 Identities = 38/80 (47%), Positives = 54/80 (67%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N ++ E   GK+VPRAV VDLEP  +D +R+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 15  NTFFAETGAGKHVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLLSGKEDAANNYARGHYT 74

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E +D  LD +RK A+ C
Sbjct: 75  VGKEHIDLALDRIRKLADQC 94


>SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1383

 Score = 90.2 bits (214), Expect = 1e-18
 Identities = 37/76 (48%), Positives = 55/76 (72%)
 Frame = +2

Query: 275  NEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAE 454
            +EA+ GKYVPRAV+VDLEP  +D VR+G +  ++ P+  + G+  A NN+A+GHYT G E
Sbjct: 965  SEAAAGKYVPRAVLVDLEPTVIDEVRTGMYRYLYHPEQMISGKEDAANNYARGHYTIGKE 1024

Query: 455  LVDSVLDVVRKEAEGC 502
            +V+ V+D +RK  + C
Sbjct: 1025 MVEVVMDKIRKMTDQC 1040


>SB_48961| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 536

 Score = 68.1 bits (159), Expect = 6e-12
 Identities = 34/80 (42%), Positives = 47/80 (58%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +             P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVV----------ALSPEQLITGKEDAANNYARGHYT 99

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G + VD VLD +RK A+ C
Sbjct: 100 IGKQQVDQVLDRLRKLADQC 119



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 389

 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 27/54 (50%), Positives = 38/54 (70%)
 Frame = +2

Query: 341 DSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGC 502
           D VR+G + Q+F P+  + G+  A NN+A+GHYT G EL+D VLD +RK A+ C
Sbjct: 13  DEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQC 66


>SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0)
          Length = 377

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 26/52 (50%), Positives = 37/52 (71%)
 Frame = +2

Query: 347 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGC 502
           VR+G + Q+F P+  + G+  A NN+A+GHYT G EL+D VLD +RK A+ C
Sbjct: 3   VRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQC 54


>SB_35594| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 24/47 (51%), Positives = 34/47 (72%)
 Frame = +2

Query: 347 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRK 487
           VR+G + Q+F P+  + G+  A NN+A+GHYT G EL+D VLD +RK
Sbjct: 3   VRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRK 49


>SB_25311| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 629

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 25/40 (62%), Positives = 30/40 (75%)
 Frame = +2

Query: 401 QSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           Q+ A NNWAKG YTEGAEL+DS +D +RK AE CD  + F
Sbjct: 2   QNSAANNWAKGFYTEGAELMDSGMDCIRKLAENCDTVQGF 41



 Score = 35.9 bits (79), Expect = 0.028
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = +1

Query: 475 CS*KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPS 636
           C  K +      QGFQ                   KIREEYPDR++++F V+PS
Sbjct: 27  CIRKLAENCDTVQGFQIAHSLGGGTGSGLGSLLLSKIREEYPDRLVSSFCVLPS 80


>SB_5512| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 365

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 23/52 (44%), Positives = 35/52 (67%)
 Frame = +2

Query: 347 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGC 502
           +R+G + Q+F P+  + G+  A NN+A+GHYT G E +D  LD +RK A+ C
Sbjct: 3   IRTGTYRQLFHPEQLLSGKEDAANNYARGHYTVGKEHIDLALDRIRKLADQC 54


>SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24)
          Length = 149

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 21/47 (44%), Positives = 30/47 (63%)
 Frame = +2

Query: 347 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRK 487
           VR G +  +F PD  + G+  A NN+A+GHYT G E +D  L+ +RK
Sbjct: 3   VRMGTYRDLFHPDQLITGKEDAANNYARGHYTVGKEHIDLTLEKIRK 49


>SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44)
          Length = 474

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 27/70 (38%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = +2

Query: 305 RAVMVDLEPGTMDSVRS--GPFGQIFRPDNFVFGQS-GAGNNWAKGHYTEGAELVDSVLD 475
           RAV +D+E   +    S     G    P    F Q  G+GNNWA G    G + +D VLD
Sbjct: 67  RAVSIDMESKVISQTLSEASKSGTWRYPKGQQFSQKRGSGNNWAHGFSEHGPKSIDKVLD 126

Query: 476 VVRKEAEGCD 505
           +V++E E CD
Sbjct: 127 LVQREVEKCD 136



 Score = 31.9 bits (69), Expect = 0.46
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +3

Query: 132 IVHIQAGQCGNQIGAKFWEVISDE 203
           IV +Q GQCGNQIG + +++I ++
Sbjct: 3   IVTLQLGQCGNQIGRELFDLIVED 26


>SB_37976| Best HMM Match : Tubulin (HMM E-Value=4.5e-18)
          Length = 553

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 28/74 (37%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
 Frame = +2

Query: 305 RAVMVDLEPGTMDSVR--SGPFGQIFRPDNFVFGQSGAGNNWAKGHYTE-----GAELVD 463
           R V VD E   + S R   G  GQ  R  N + G+ G GNN+A G++       G  L+ 
Sbjct: 40  RCVCVDSESKVIASNRRSDGVHGQN-RDSNIIAGRRGRGNNFALGYHGNSIDEGGTSLLH 98

Query: 464 SVLDVVRKEAEGCD 505
             +D +RKE E CD
Sbjct: 99  MTMDAMRKEVERCD 112


>SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32)
          Length = 488

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 15/40 (37%), Positives = 24/40 (60%)
 Frame = +2

Query: 305 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNW 424
           RAV++D+E G ++++  GP   +F     +   SG GNNW
Sbjct: 76  RAVLIDMEEGVVNNILKGPLHDVFDCQQLITDVSGCGNNW 115


>SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 94

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 15/30 (50%), Positives = 22/30 (73%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVR 352
           N +++E  GGK+VPRAV VDLEP  +  ++
Sbjct: 50  NTFFSETGGGKHVPRAVFVDLEPSVVGRMK 79



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 17/42 (40%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + +  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 196 MRECLSIHVGQAGVQIGNACWELYCLEHGIQPDGHMPSD 234


>SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0)
          Length = 375

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                    ++EEYPDRI+++ SV PS +
Sbjct: 12  QGFQLLHSLGGGTGSGLGTLILYHLQEEYPDRILSSVSVFPSPR 55


>SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 38

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 11/15 (73%), Positives = 13/15 (86%)
 Frame = +3

Query: 180 FWEVISDEHGIDATG 224
           FWEVI++EHGID  G
Sbjct: 1   FWEVIAEEHGIDPDG 15


>SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083)
          Length = 1266

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 22/53 (41%), Positives = 24/53 (45%)
 Frame = -2

Query: 467  PNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 309
            P+Q VQ PL   L P Y PP  V            TA   R P  Q QGPP+Q
Sbjct: 1080 PHQAVQQPLPQQLPPQYRPPAIV------------TAAVARPP--QVQGPPTQ 1118


>SB_50693| Best HMM Match : C2 (HMM E-Value=0)
          Length = 1049

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
 Frame = -1

Query: 411 APDCPKTKLSGRKICPNGPERTESMVPGSRSTITAR----GTYLP 289
           A DCP ++ +GR +CP  P   +S +  ++++I       GT+ P
Sbjct: 138 AVDCPTSRKNGRGLCPFPPPPLQSALKRAKASIEVNDFTLGTHTP 182


>SB_47545| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 406

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 31/122 (25%), Positives = 47/122 (38%), Gaps = 17/122 (13%)
 Frame = -3

Query: 604 DLDTLHGFWKSKESPYQIQ----------------YLLPENELAENPATIAAFCFFSNYI 473
           +L ++HG  KSK +PY  Q                  LP ++    P  +   CF  N  
Sbjct: 148 ELCSVHGLKKSKTTPYHTQGNGLCERLNRTLHELLRTLPPDKKRRWPDHLRQLCFAYNAT 207

Query: 472 QYRINQFSPLCVMSFRPVIPRPRLSEDEVVRSEDLPKRPGTDGV-HGSRLKVHHHSSRDV 296
            +    +SP  VM  R     P+L  D ++  E+   +P T    H   L+  H  +   
Sbjct: 208 SHSTTGYSPFFVMYERD----PKLHIDRLIGEEETMDKPDTWVTRHTKELRKAHRRAAKR 263

Query: 295 LA 290
           LA
Sbjct: 264 LA 265


>SB_17458| Best HMM Match : Metalloenzyme (HMM E-Value=0.29)
          Length = 190

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +3

Query: 201 EHGIDATGAYSGDSDLQLNASMSTITK 281
           +HG+  TG + GDSD +L+A++   +K
Sbjct: 137 DHGMTRTGDHGGDSDDELDAALFVYSK 163


>SB_50370| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1059

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 9/21 (42%), Positives = 16/21 (76%)
 Frame = +1

Query: 580 KIREEYPDRIMNTFSVVPSSK 642
           K++E+YPD I+++F + P  K
Sbjct: 486 KLQEQYPDHILSSFELFPCEK 506


>SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1010

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = -1

Query: 402 CPKTKLSGRKICPNGPERTESMVPGSRSTITARGTYLPPEA 280
           CP+  +  RK  P+G +  +    G+ S + ++G  +PP A
Sbjct: 456 CPQGNMDYRKAAPDGRDMQQMGQKGNFSQMLSQGRGMPPGA 496


>SB_34911| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 904

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 1/51 (1%)
 Frame = -2

Query: 455 VQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRS-PWFQAQGPPSQL 306
           V PP+C+ L    S P      S      A+ A++G +  W + + P +QL
Sbjct: 193 VHPPICDCLGCRISSPVVASPESIREAFEAENAKDGNADDWGEVKTPTNQL 243


>SB_46977| Best HMM Match : Cu_amine_oxid (HMM E-Value=3.9e-09)
          Length = 549

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = -3

Query: 529 ELAENPATIAAFCFFSNYIQYRINQFSPLCVMSFRPVIPRPRLSEDEVVRSEDL 368
           EL  +     A+C    +++ R N   P  + +F+P  P  RLSE E+VR  DL
Sbjct: 386 ELNTDQRVYLAWCIL--FVETRGN---PKSLKAFQPFWPAIRLSELELVRRSDL 434


>SB_23752| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 620

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = -2

Query: 479 LHPVPNQPVQPPLCNVLSPSYSPP 408
           L PVP+ P Q P     +P+++PP
Sbjct: 476 LDPVPSAPTQAPTPTPAAPTHAPP 499


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,236,175
Number of Sequences: 59808
Number of extensions: 450012
Number of successful extensions: 1248
Number of sequences better than 10.0: 38
Number of HSP's better than 10.0 without gapping: 1096
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1245
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1645141000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).