SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0034
         (598 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_23494| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.2  
SB_6388| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   2.9  
SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_40133| Best HMM Match : Tat (HMM E-Value=1.4)                       27   8.7  
SB_36466| Best HMM Match : Tat (HMM E-Value=1.4)                       27   8.7  

>SB_23494| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1013

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = +3

Query: 15  TQPAVTLRIYSAERPASTWIRRNRDTRPLLDTSSTSPIIGIRK 143
           T+PA TL I+  E PA+  I   R+T   L      PI+ +R+
Sbjct: 852 TRPAYTLIIHERETPAALIIIHARETNAALIIIHLLPIVRVRE 894


>SB_6388| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1520

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 14/47 (29%), Positives = 27/47 (57%)
 Frame = -1

Query: 241 ISIWFRDLEDCVRLDDYLLIKSWVEESDFGCNSFLIPIIGDVDEVSN 101
           +S W R++ D    D+   ++ WV+++  G  S++   I DVDE+ +
Sbjct: 50  LSCWRRNIADVTVDDERTKLREWVDKTKKG--SWISRWISDVDEIES 94


>SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1524

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = +2

Query: 140 EAIAAEIGFFHPRFDKEVVIKSNAVFKVPEPN 235
           EA+ AEI    P+ ++EVV++S A     EP+
Sbjct: 523 EALKAEIDALKPKIEEEVVVQSAAPVAAGEPD 554


>SB_40133| Best HMM Match : Tat (HMM E-Value=1.4)
          Length = 160

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = +3

Query: 345 NTICKGYRLRRNSGRAKQGEDPAGQVEVQ 431
           N IC   R RR S +AK+  D   QVE +
Sbjct: 97  NAICSRRRRRRTSAKAKRKIDTQSQVEFE 125


>SB_36466| Best HMM Match : Tat (HMM E-Value=1.4)
          Length = 102

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = +3

Query: 345 NTICKGYRLRRNSGRAKQGEDPAGQVEVQ 431
           N IC   R RR S +AK+  D   QVE +
Sbjct: 39  NAICSRRRRRRTSAKAKRKIDTQSQVEFE 67


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,697,928
Number of Sequences: 59808
Number of extensions: 381895
Number of successful extensions: 897
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 788
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 897
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1439498375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).