SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0033
         (698 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_47198| Best HMM Match : Tubulin (HMM E-Value=0)                    174   7e-44
SB_17879| Best HMM Match : Tubulin (HMM E-Value=0)                    174   7e-44
SB_39308| Best HMM Match : Tubulin (HMM E-Value=0)                    168   3e-42
SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0)                  140   7e-34
SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34)                138   3e-33
SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28)            138   3e-33
SB_25311| Best HMM Match : Tubulin (HMM E-Value=0)                    108   4e-24
SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.)              95   5e-20
SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.)              94   9e-20
SB_2003| Best HMM Match : Tubulin (HMM E-Value=0)                      93   1e-19
SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.)              93   3e-19
SB_19437| Best HMM Match : Tubulin (HMM E-Value=0)                     93   3e-19
SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.)              92   5e-19
SB_5512| Best HMM Match : Tubulin (HMM E-Value=0)                      92   5e-19
SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0)                   91   6e-19
SB_34400| Best HMM Match : Tubulin (HMM E-Value=0)                     91   6e-19
SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.)              91   8e-19
SB_2674| Best HMM Match : Tubulin (HMM E-Value=0)                      91   8e-19
SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0)                   91   8e-19
SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0)                   91   8e-19
SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)              91   1e-18
SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.)              86   3e-17
SB_48961| Best HMM Match : Tubulin (HMM E-Value=0)                     63   2e-10
SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32)             62   6e-10
SB_16885| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   4e-06
SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24)                44   2e-04
SB_59740| Best HMM Match : Tubulin (HMM E-Value=2.1e-25)               36   0.032
SB_17881| Best HMM Match : Tubulin (HMM E-Value=0)                     30   1.6  
SB_48118| Best HMM Match : DUF1314 (HMM E-Value=3.2)                   29   3.6  
SB_20374| Best HMM Match : zf-U1 (HMM E-Value=1.7)                     29   3.6  
SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32)                  29   4.8  
SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.3  

>SB_47198| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 446

 Score =  174 bits (423), Expect = 7e-44
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAMFRG 319



 Score =  164 bits (398), Expect = 7e-41
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>SB_17879| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 446

 Score =  174 bits (423), Expect = 7e-44
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAMFRG 319



 Score =  164 bits (398), Expect = 7e-41
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>SB_39308| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 391

 Score =  168 bits (409), Expect = 3e-42
 Identities = 78/93 (83%), Positives = 83/93 (89%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRL F+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 179 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLPFFMPGFAPLTSRGSQQYRALTVPELTQQM 238

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKL 280
           FDAKNMM ACDP HGRYLTVA +FRG    K+L
Sbjct: 239 FDAKNMMAACDPLHGRYLTVAAMFRGRMSMKEL 271



 Score =  163 bits (395), Expect = 2e-40
 Identities = 70/85 (82%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKE+DEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 263 RGRMSMKELDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 322

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 323 FKRISEQFTAMFRRKAFLHWYTGEG 347



 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 338 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 371


>SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0)
          Length = 375

 Score =  140 bits (340), Expect = 7e-34
 Identities = 60/86 (69%), Positives = 74/86 (86%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNM+P+PRLHF+ PGFAPLTSR    YRALTV +LT  +
Sbjct: 139 SGLTTCLRFPGQLNADLRKLAVNMIPYPRLHFFMPGFAPLTSRECVSYRALTVADLTQAI 198

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD KN+++AC+P+ G+YLT A ++RG
Sbjct: 199 FDNKNLLIACNPKRGKYLTYAAMYRG 224



 Score =  113 bits (273), Expect = 1e-25
 Identities = 48/85 (56%), Positives = 67/85 (78%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G MSMKEV++Q+A  Q++ S+ FV+WIPNN K+AVCD+PP  +KM+++ I + TAIQ +
Sbjct: 223 RGLMSMKEVEDQMAFAQDRYSSLFVDWIPNNGKVAVCDVPPHDMKMSASCISSNTAIQEL 282

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+   +  MFRR+AFLHWYT EG
Sbjct: 283 FKRIRLHYKLMFRRRAFLHWYTEEG 307



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 3/32 (9%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQ 572
           A +HW    G D  +F EA++++ DLIS YQQ
Sbjct: 298 AFLHWYTEEGMDSQQFEEADNDILDLISTYQQ 329


>SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34)
          Length = 747

 Score =  138 bits (335), Expect = 3e-33
 Identities = 60/77 (77%), Positives = 66/77 (85%)
 Frame = +1

Query: 277 VDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSEQF 456
           VDEQ+ N QNKNS +FVEWIPNN K  VCDI P+GLKMA+TF+GN TAIQ +FKRV EQF
Sbjct: 91  VDEQMLNTQNKNSPFFVEWIPNNVKTTVCDIAPKGLKMAATFVGNNTAIQELFKRVGEQF 150

Query: 457 VAMFRRKAFLHWYTGEG 507
            AMFRRKAFLHWYTGEG
Sbjct: 151 TAMFRRKAFLHWYTGEG 167



 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNM+DLI+EYQQYQ
Sbjct: 158 AFLHWYTGEGMDEMEFTEAESNMHDLIAEYQQYQ 191


>SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28)
          Length = 271

 Score =  138 bits (335), Expect = 3e-33
 Identities = 60/77 (77%), Positives = 66/77 (85%)
 Frame = +1

Query: 277 VDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSEQF 456
           VDEQ+ N QNKNS +FVEWIPNN K  VCDI P+GLKMA+TF+GN TAIQ +FKRV EQF
Sbjct: 153 VDEQMLNTQNKNSPFFVEWIPNNVKTTVCDIAPKGLKMAATFVGNNTAIQELFKRVGEQF 212

Query: 457 VAMFRRKAFLHWYTGEG 507
            AMFRRKAFLHWYTGEG
Sbjct: 213 TAMFRRKAFLHWYTGEG 229



 Score =  111 bits (268), Expect = 4e-25
 Identities = 49/64 (76%), Positives = 55/64 (85%)
 Frame = +2

Query: 71  MVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAKNMMVACDPRHGRYLTVATI 250
           MVPFPRLHF+ PGFAPL SR  QQY+ ++V ELT QMFDA+NMM ACDPRHGRYLTVA I
Sbjct: 1   MVPFPRLHFFMPGFAPLASRANQQYQNVSVEELTQQMFDARNMMTACDPRHGRYLTVAAI 60

Query: 251 FRGE 262
           FRG+
Sbjct: 61  FRGK 64



 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNM+DLI+EYQQYQ
Sbjct: 220 AFLHWYTGEGMDEMEFTEAESNMHDLIAEYQQYQ 253


>SB_25311| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 629

 Score =  108 bits (260), Expect = 4e-24
 Identities = 47/69 (68%), Positives = 57/69 (82%)
 Frame = +1

Query: 301 QNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKA 480
           Q+ +S+ FVEWIPNN K AVCD+PP GLK A+TF+ N+TAIQ  F+R +EQF AMFRR+A
Sbjct: 153 QDSHSSSFVEWIPNNMKTAVCDVPPVGLKNAATFLYNSTAIQEAFRRFTEQFAAMFRRRA 212

Query: 481 FLHWYTGEG 507
           FLHWYT EG
Sbjct: 213 FLHWYTTEG 221



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +3

Query: 522 FTEAESNMNDLISEYQQYQ 578
           +  A+SN+NDLISEYQQY+
Sbjct: 256 YFSADSNLNDLISEYQQYE 274


>SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 865

 Score = 95.1 bits (226), Expect = 5e-20
 Identities = 43/103 (41%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 221 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITTSC 280

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    +FRG+ + K + +     +TK
Sbjct: 281 FEPANQMVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTK 323



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 35/91 (38%), Positives = 53/91 (58%)
 Frame = +2

Query: 38  LNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAKNMMVACDP 217
           LN DL +   N+VP+PR+HF    +AP+ S     +  +TV +LT   F+  N MV CDP
Sbjct: 664 LNVDLMEFQTNLVPYPRIHFPMATYAPIISAEKAYHEMMTVSDLTNACFEPANQMVKCDP 723

Query: 218 RHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           RHG+Y+    +FRG+ + K + +     +TK
Sbjct: 724 RHGKYMACCLLFRGDVVPKDVNAAIATIKTK 754



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 301 CLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 360

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 361 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 397



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241  CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
            C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 732  CLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 791

Query: 397  TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
              + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 792  CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 828


>SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1231

 Score = 94.3 bits (224), Expect = 9e-20
 Identities = 42/103 (40%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV ++T   
Sbjct: 607 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPMASYAPVVSAEKAYHEQLTVADITNSC 666

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + S     +TK
Sbjct: 667 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTK 709



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 691 RGDVVPKDVNSAIATIKTKKTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 750

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 751 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 783



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 29/67 (43%), Positives = 38/67 (56%)
 Frame = +2

Query: 2    SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
            S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 1040 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNAC 1099

Query: 182  FDAKNMM 202
            F+  N M
Sbjct: 1100 FEPANQM 1106



 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 31/102 (30%), Positives = 53/102 (51%), Gaps = 8/102 (7%)
 Frame = +1

Query: 226  EVFDRCDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------G 381
            E+ + C +   +M   +V+  +A I+ K +  FV+W P   K+ +   PP          
Sbjct: 1094 EITNACFEPANQM---DVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAK 1150

Query: 382  LKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
            ++ A   + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 1151 VQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 1192


>SB_2003| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 451

 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 42/103 (40%), Positives = 61/103 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + S+    +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSSIATIKTK 338



 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNSSIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 452

 Score = 92.7 bits (220), Expect = 3e-19
 Identities = 42/103 (40%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>SB_19437| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 885

 Score = 92.7 bits (220), Expect = 3e-19
 Identities = 42/103 (40%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 669 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNAC 728

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 729 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 771



 Score = 91.1 bits (216), Expect = 8e-19
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 30/97 (30%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTA+   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEG 412



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253  QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
            +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 753  RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 812

Query: 409  NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
            NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 813  NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 845


>SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 417

 Score = 91.9 bits (218), Expect = 5e-19
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  +TV +LT   
Sbjct: 201 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPMATYAPIISAEKAYHEMMTVSDLTNAC 260

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 261 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 303



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 285 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 344

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 345 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 377


>SB_5512| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 365

 Score = 91.9 bits (218), Expect = 5e-19
 Identities = 42/103 (40%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 161 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNSC 220

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     R K
Sbjct: 221 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIRPK 263



 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 24/85 (28%), Positives = 42/85 (49%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G +  K+V+  +A I+ K +  F +W P   K+ +   PP  +            I   
Sbjct: 245 RGDVVPKDVNAAIATIRPKRTFQFGDWCPTGFKVGINSQPPTVVPGGDL----AKPIAEA 300

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           + R+  +F  M+ ++AF+HWY GEG
Sbjct: 301 WARLDHKFDLMYAKRAFVHWYVGEG 325


>SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0)
          Length = 232

 Score = 91.5 bits (217), Expect = 6e-19
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV ++T   
Sbjct: 34  SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVADITNAC 93

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 94  FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 136



 Score = 57.6 bits (133), Expect = 9e-09
 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGL--------KMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +    P  +        + +   + 
Sbjct: 118 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQQPTAVPGGDLAKVQRSVCMLS 177

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R++ +F  M+ ++AF+HWY GEG
Sbjct: 178 NTTAIADAWARLNHKFDLMYAKRAFVHWYVGEG 210


>SB_34400| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 380

 Score = 91.5 bits (217), Expect = 6e-19
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV ++T   
Sbjct: 235 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVADITNAC 294

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 295 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 337



 Score = 31.1 bits (67), Expect = 0.90
 Identities = 13/50 (26%), Positives = 25/50 (50%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTF 402
           +G +  K+V+  +A I+ K +  FV+W P   K+ +    P     A+ +
Sbjct: 319 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGIRHKAPGHFSWATVY 368


>SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 389

 Score = 91.1 bits (216), Expect = 8e-19
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 173 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 232

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 233 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 275



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 253 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 312

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 313 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 349


>SB_2674| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 1036

 Score = 91.1 bits (216), Expect = 8e-19
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 300 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 359

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 360 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 402



 Score = 91.1 bits (216), Expect = 8e-19
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2    SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
            S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 821  SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 880

Query: 182  FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
            F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 881  FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 923



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253  QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
            +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 905  RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 964

Query: 409  NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
            NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 965  NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 997



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP 375
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP
Sbjct: 380 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP 424


>SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0)
          Length = 377

 Score = 91.1 bits (216), Expect = 8e-19
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 161 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 220

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 221 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 263



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 241 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 300

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 301 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 337


>SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0)
          Length = 250

 Score = 91.1 bits (216), Expect = 8e-19
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 34  SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 93

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 94  FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 136



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 114 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 173

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 174 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 210


>SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1383

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 39/87 (44%), Positives = 54/87 (62%)
 Frame = +2

Query: 2    SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
            S IT+ LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV ++T   
Sbjct: 1147 SSITSSLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISPEKAYHEQLTVAQITNMC 1206

Query: 182  FDAKNMMVACDPRHGRYLTVATIFRGE 262
            FD  N MV CDPRHG+Y+    ++RG+
Sbjct: 1207 FDPNNQMVKCDPRHGKYMACCMLYRGD 1233


>SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 85.8 bits (203), Expect = 3e-17
 Identities = 36/95 (37%), Positives = 56/95 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S +T  LRF G LN DL +   N+VP+PR+HF    +AP+       +  ++V E+T   
Sbjct: 367 SSVTASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVIGADKAYHENMSVAEITSAC 426

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTS 286
           F+  N MV CDPR+G+Y+    ++RG+ + K + S
Sbjct: 427 FEPSNQMVKCDPRYGKYMACCLLYRGDVVPKDVNS 461



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 17/42 (40%), Positives = 27/42 (64%)
 Frame = +1

Query: 382 LKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           ++ A   + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 523 VQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 564



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 16/54 (29%), Positives = 26/54 (48%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNT 414
           +G +  K+V+  +A I+ K +  FV+W P   K    +I  +  K   TF   T
Sbjct: 451 RGDVVPKDVNSAIAAIKMKRTIQFVDWCPTGFKCHP-NISDKQKKSTKTFYSGT 503


>SB_48961| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 536

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 30/93 (32%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G + +K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 304 EGDVVLKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 363

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 364 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 396



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 25/57 (43%), Positives = 34/57 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELT 172
           S +T  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T
Sbjct: 226 SSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEIT 282


>SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32)
          Length = 488

 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 27/84 (32%), Positives = 44/84 (52%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFD 187
           +T+  RF G LN DL ++ +N+VPFP+LH+      PL +    +     + ++    F 
Sbjct: 285 MTSSARFEGSLNVDLNEITMNLVPFPKLHYLVSSQTPLYALTDVKLPPRRLDQMFTDAFS 344

Query: 188 AKNMMVACDPRHGRYLTVATIFRG 259
             + ++  DP+H  YL  A I RG
Sbjct: 345 KDHQLIKADPKHNLYLACALILRG 368



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +1

Query: 274 EVDEQLANIQN-KNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSE 450
           EV +   NI+  K S  F+ W     K  +C +PP G   +   + N + I+  F  + +
Sbjct: 371 EVSDIRRNIERLKPSLKFIHWNQEGWKTGLCSVPPVGQPYSLLTLANNSCIKNTFVELKD 430

Query: 451 QFVAMFRRKAFLHWYT 498
           +F+ +++RKA +H YT
Sbjct: 431 RFMKLYKRKAHVHHYT 446


>SB_16885| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 455

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 20/39 (51%), Positives = 27/39 (69%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS 127
           TT LR+PG +N DL  L  +++P PRLHF   G+ PLT+
Sbjct: 276 TTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTT 314


>SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24)
          Length = 149

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 16/35 (45%), Positives = 25/35 (71%)
 Frame = +1

Query: 403 IGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           + NTTAI   + R++ +F  M+ ++AF+HWY GEG
Sbjct: 76  LSNTTAIADAWARLNHKFDLMYAKRAFVHWYVGEG 110


>SB_59740| Best HMM Match : Tubulin (HMM E-Value=2.1e-25)
          Length = 139

 Score = 35.9 bits (79), Expect = 0.032
 Identities = 15/28 (53%), Positives = 18/28 (64%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFP 85
           S IT  LRF G LN DL +   N+VP+P
Sbjct: 111 SSITASLRFDGALNVDLTEFQTNLVPYP 138


>SB_17881| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 458

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 11/12 (91%), Positives = 12/12 (100%)
 Frame = +2

Query: 2   SGITTCLRFPGQ 37
           SG+TTCLRFPGQ
Sbjct: 447 SGVTTCLRFPGQ 458


>SB_48118| Best HMM Match : DUF1314 (HMM E-Value=3.2)
          Length = 341

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = +2

Query: 101 TPGFAPLTSRGAQQYRALTVPELTLQMFDAKNM--MVACDPRHGRYLTVA 244
           +PG+  L++ G+ Q    T P +T +M+  K     +A  P   R+ T+A
Sbjct: 117 SPGYLSLSAFGSPQVSRSTTPGITYEMYGVKERGNSLAARPATSRHATLA 166


>SB_20374| Best HMM Match : zf-U1 (HMM E-Value=1.7)
          Length = 783

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 14/29 (48%), Positives = 18/29 (62%)
 Frame = -3

Query: 432 YGLYGRRVTNEGRSHFKTPRRYVTHGNLA 346
           Y L GR    +GRSH +TP+ YV   NL+
Sbjct: 74  YLLSGRGKHGKGRSHRQTPQEYVDTHNLS 102


>SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32)
          Length = 458

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +1

Query: 196 HDGRV*SSTREVFDRCDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIA-VCD 366
           HDGR+ +S  E  D   DI    +M E  E++  +Q    T+ V W PN   +A  CD
Sbjct: 285 HDGRMLASGSE--DLIIDI----AMVETGERICEVQCHAPTFTVAWHPNKPLLAFACD 336


>SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = +1

Query: 466 FRRKAFLHWYTGEG 507
           + ++AF+HWY GEG
Sbjct: 13  YAKRAFVHWYVGEG 26


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,906,562
Number of Sequences: 59808
Number of extensions: 429473
Number of successful extensions: 1233
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 1090
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1216
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1829596184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).