SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0032
         (648 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_17447| Best HMM Match : zf-B_box (HMM E-Value=0.04)                 33   0.20 
SB_44409| Best HMM Match : PDZ (HMM E-Value=7.1e-33)                   31   1.1  
SB_39877| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.7  
SB_947| Best HMM Match : Phage_term_smal (HMM E-Value=2.8)             28   5.7  
SB_51745| Best HMM Match : DPRP (HMM E-Value=0.33)                     28   7.5  
SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.5  
SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13)         28   7.5  
SB_51743| Best HMM Match : DPRP (HMM E-Value=0.4)                      28   7.5  
SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.5  
SB_35375| Best HMM Match : RVT_1 (HMM E-Value=0.00074)                 28   7.5  
SB_1692| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.5  
SB_4089| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.9  
SB_1964| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.9  
SB_24095| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.9  

>SB_17447| Best HMM Match : zf-B_box (HMM E-Value=0.04)
          Length = 1223

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +1

Query: 313  SH-PLEAAADRRNPQVRRQGPXDVSAQSFCSARSYAPTRLSTSSTSPIL 456
            SH PL+++   +N  + +QGP  VS++   +  + AP R  +S T P++
Sbjct: 958  SHTPLKSSVSAKNCNLPKQGPVTVSSKPAIALTTLAPQRTLSSLTGPLI 1006


>SB_44409| Best HMM Match : PDZ (HMM E-Value=7.1e-33)
          Length = 718

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 3/80 (3%)
 Frame = +2

Query: 224 RRGILFRASERDXQDAANSIMGXVVXNIE-PHIHWKPQLIDGILKYGDRVXTMSLPRASA 400
           RRG +    +++ Q+      G +  ++  P    + +L   +++Y       ++P  S 
Sbjct: 564 RRGDILHVVDQEDQNWWQGDSGLITCSVTGPPKIGRKELRQRLIQYDPDRFAGAIPHTSR 623

Query: 401 P--PGATPQRDYRPVPRHQF 454
           P  PG     DY  VPRH F
Sbjct: 624 PIKPGEINDHDYHFVPRHTF 643


>SB_39877| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 555

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 13/20 (65%), Positives = 14/20 (70%)
 Frame = +1

Query: 112 VKKMKKRA*WNHWTTPAWGS 171
           VKKM K A WN + T AWGS
Sbjct: 172 VKKMMKHA-WNGYVTYAWGS 190


>SB_947| Best HMM Match : Phage_term_smal (HMM E-Value=2.8)
          Length = 237

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMSLP 388
           PQL+DG+L+ G R+    LP
Sbjct: 124 PQLVDGVLRVGGRIDKADLP 143


>SB_51745| Best HMM Match : DPRP (HMM E-Value=0.33)
          Length = 352

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMSLPRASAPP 406
           PQL+DG+L+ G R+    +P  +  P
Sbjct: 220 PQLVDGVLRVGGRIDRADIPWETKHP 245


>SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 989

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMSLPRASAPP 406
           PQL+DG+L+ G R+    +P  +  P
Sbjct: 727 PQLVDGVLRVGGRIDRADIPWETKHP 752


>SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13)
          Length = 1012

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329  PQLIDGILKYGDRVXTMSLPRASAPP 406
            PQL+DG+L+ G R+    +P  +  P
Sbjct: 945  PQLVDGVLRVGGRIDRADIPWETKHP 970


>SB_51743| Best HMM Match : DPRP (HMM E-Value=0.4)
          Length = 281

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMSLPRASAPP 406
           PQL+DG+L+ G R+    +P  +  P
Sbjct: 233 PQLVDGVLRVGGRIDRADIPWETKHP 258


>SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1497

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329  PQLIDGILKYGDRVXTMSLPRASAPP 406
            PQL+DG+L+ G R+    +P  +  P
Sbjct: 1144 PQLVDGVLRVGGRIDRADIPWETKHP 1169


>SB_35375| Best HMM Match : RVT_1 (HMM E-Value=0.00074)
          Length = 996

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = +1

Query: 142 NHWTTPAWGSTWTASXXS*LRSEEDW-HKTRNSF*SXGTRSXGRG 273
           NH+    WG   T    +  R ++ W H++RN     G+R+ G+G
Sbjct: 71  NHYARMCWGGAKTKDETTSERQDQRWKHQSRN----FGSRNKGKG 111


>SB_1692| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 190

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMSLPRASAPP 406
           PQL+DG+L+ G R+    +P  +  P
Sbjct: 150 PQLVDGVLRVGGRIDRADIPWETKHP 175


>SB_4089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 289

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMSLP 388
           PQL+DG+L+ G R+    LP
Sbjct: 176 PQLVDGMLRVGGRIDRADLP 195


>SB_1964| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 88

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%)
 Frame = +1

Query: 310 TSHPLEAAA--DRRNPQVRRQGPXDVSAQSFCSARSYAPTRLST 435
           T  P  AA+  D+ NP++ R  P D+SAQ      ++ P++ ST
Sbjct: 31  TGRPKNAASSIDQVNPEIHR--PRDLSAQRTIDPANHRPSKPST 72


>SB_24095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1162

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 9/20 (45%), Positives = 14/20 (70%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMSLP 388
           PQL+DG+L+ G R+    +P
Sbjct: 901 PQLVDGVLRVGGRIDRADIP 920


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,843,118
Number of Sequences: 59808
Number of extensions: 246279
Number of successful extensions: 526
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 468
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 526
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1645141000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).