SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0029
         (499 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_40415| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_21315| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.92 
SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092)               30   1.2  
SB_35264| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.6  
SB_19751| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.1  
SB_18162| Best HMM Match : E-MAP-115 (HMM E-Value=0.21)                29   2.8  
SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0)                28   4.9  
SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.5  
SB_22840| Best HMM Match : F5_F8_type_C (HMM E-Value=0)                27   6.5  
SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06)                  27   6.5  

>SB_40415| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1512

 Score = 31.9 bits (69), Expect = 0.30
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = -3

Query: 401 PTSEPRQRTASRALEDRGATYAERSSTRALRPYSSEERRSGTET 270
           P S P++RT+S A    G   A  +S  +   YS+E   SG+E+
Sbjct: 867 PRSPPKRRTSSEAFYTEGLPLAPSTSLTSSSAYSTEGLASGSES 910


>SB_21315| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 326

 Score = 30.3 bits (65), Expect = 0.92
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 7/84 (8%)
 Frame = -3

Query: 461 NEKHRSNSELQY*AASRRH----FPTSEPRQRTASRALEDRG---ATYAERSSTRALRPY 303
           N + R  S   Y    RR     + T + RQ  AS + +DR    A+Y+ +   +++  Y
Sbjct: 29  NTQDRRQSMASYNTQDRRQSMASYSTQDRRQSMASYSTQDRRQSMASYSTQDRRQSMASY 88

Query: 302 SSEERRSGTETA*LQTPSQFSFGY 231
           S+++RR    +   Q   +F   Y
Sbjct: 89  STQDRRQSMASYNTQDRRRFMASY 112


>SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092)
          Length = 783

 Score = 29.9 bits (64), Expect = 1.2
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -3

Query: 464 ENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDR 351
           E EK+  + EL+    S  HF   E ++R   RA+ED+
Sbjct: 332 EEEKYGKDGELRMLKESLAHFQAEEAKKREQIRAMEDQ 369


>SB_35264| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 619

 Score = 29.5 bits (63), Expect = 1.6
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = -2

Query: 426 LSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLN 322
           L G S  FP  RT  + ++ S  RPRC     ++N
Sbjct: 456 LLGSSGDFPRKRTNQSQNMTSLPRPRCKATSTRIN 490


>SB_19751| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2644

 Score = 29.1 bits (62), Expect = 2.1
 Identities = 18/76 (23%), Positives = 29/76 (38%), Gaps = 8/76 (10%)
 Frame = -2

Query: 354 PRCHVRGAKLNARSTSILVRGA---SLGNGDSVTSNAIAVLIWVWR-----LTDHLTTAS 199
           P+C +R  K        + + +       G   T ++     W W      LTDH TT +
Sbjct: 299 PKCRIRSYKFCLAVAGAIAQTSPDCDFEKGMCYTQDSTDTFDWTWDIANSPLTDHTTTVT 358

Query: 198 NGSDSSSRGTEYSTTC 151
           +GS  ++ G      C
Sbjct: 359 SGSTFTTAGNGQGAPC 374


>SB_18162| Best HMM Match : E-MAP-115 (HMM E-Value=0.21)
          Length = 659

 Score = 28.7 bits (61), Expect = 2.8
 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 2/78 (2%)
 Frame = -3

Query: 470 NTENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGA--TYAERSSTRALRPYSS 297
           N E  K R+ + L+  A  R H      R    ++  E  GA   YAERS   A R  SS
Sbjct: 456 NAEAWKRRAWARLE--AEQRHHEEQQRRRAEELAKLAELAGAHKRYAERSQETARRRRSS 513

Query: 296 EERRSGTETA*LQTPSQF 243
             RR+         P Q+
Sbjct: 514 RRRRNKKRLQMGAAPGQY 531


>SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0)
          Length = 1831

 Score = 27.9 bits (59), Expect = 4.9
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +2

Query: 284  SDAPLTSMDVERALSFAPRTWHRGLQELWRLFAVVVRMLGNVGDWP 421
            SD P+T +     LS  P + H G  E +  + + V+   N+GD P
Sbjct: 1715 SDPPITDL----CLSLYPLSMHLGGLEPYTEYVITVKAYTNIGDGP 1756


>SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 117

 Score = 27.5 bits (58), Expect = 6.5
 Identities = 12/37 (32%), Positives = 17/37 (45%)
 Frame = +2

Query: 341 TWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 451
           TW  G  E WRL  +     G++  W L ++   S G
Sbjct: 63  TWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 99



 Score = 27.5 bits (58), Expect = 6.5
 Identities = 12/37 (32%), Positives = 17/37 (45%)
 Frame = +2

Query: 341 TWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 451
           TW  G  E WRL  +     G++  W L ++   S G
Sbjct: 79  TWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 115


>SB_22840| Best HMM Match : F5_F8_type_C (HMM E-Value=0)
          Length = 4002

 Score = 27.5 bits (58), Expect = 6.5
 Identities = 14/42 (33%), Positives = 22/42 (52%)
 Frame = +2

Query: 317  RALSFAPRTWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRC 442
            R L   PR W+R +     L+    R +GN+ + P++ V RC
Sbjct: 2023 RFLRIHPRNWYRHISMRIELYGKRNRFVGNICNLPMS-VGRC 2063


>SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06)
          Length = 259

 Score = 27.5 bits (58), Expect = 6.5
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = -2

Query: 228 RLTDHLTTASNGSDSSSRGTEYST 157
           RLT++  +ASNGSD  +   E ST
Sbjct: 2   RLTNYTLSASNGSDDETSNKEVST 25


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,564,814
Number of Sequences: 59808
Number of extensions: 260497
Number of successful extensions: 884
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 794
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 863
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1075029208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).