SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0028
         (598 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_52311| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.076
SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.71 
SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58)                      30   1.2  
SB_159| Best HMM Match : TP2 (HMM E-Value=0.58)                        30   1.2  
SB_46216| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.2  
SB_16839| Best HMM Match : zf-GRF (HMM E-Value=3.7e-15)                29   2.2  
SB_26078| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.45)           29   3.8  
SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.0  
SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.0  
SB_31861| Best HMM Match : rve (HMM E-Value=3.6e-07)                   28   6.6  

>SB_52311| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 506

 Score = 34.3 bits (75), Expect = 0.076
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 3/45 (6%)
 Frame = -1

Query: 583 HNRLTVPSQSNRQTVTL---FPHNTRTVRSFCFERVQLYNGNCPH 458
           HN +T+PSQ N  T+T+   + HNT T+ S            C H
Sbjct: 384 HNTITIPSQYNHNTITIPSQYHHNTNTIPSQYHHNTITIPSQCHH 428



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 3/30 (10%)
 Frame = -1

Query: 583 HNRLTVPSQSNRQTVTL---FPHNTRTVRS 503
           HN +T+PSQ +R T+T+   + HNT  + S
Sbjct: 252 HNTITIPSQYHRNTITIQSQYHHNTIAIPS 281



 Score = 29.1 bits (62), Expect = 2.9
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 3/30 (10%)
 Frame = -1

Query: 583 HNRLTVPSQSNRQTVTL---FPHNTRTVRS 503
           HN +T+PSQ +  T+T+     HNT T+ S
Sbjct: 149 HNTITIPSQYHHNTITIPSRHQHNTITIPS 178



 Score = 28.3 bits (60), Expect = 5.0
 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 3/30 (10%)
 Frame = -1

Query: 583 HNRLTVPSQSNRQTVTL---FPHNTRTVRS 503
           HN +T+PS+  + T+T+   + HNT T+ S
Sbjct: 94  HNTITIPSRHQQNTITIPSQYHHNTITMPS 123



 Score = 27.5 bits (58), Expect = 8.7
 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 3/27 (11%)
 Frame = -1

Query: 583 HNRLTVPSQSNRQTVTL---FPHNTRT 512
           HN +T+PSQ +R T+ +   + HNT T
Sbjct: 116 HNTITMPSQYHRNTIAIPSQYHHNTIT 142



 Score = 27.5 bits (58), Expect = 8.7
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 3/30 (10%)
 Frame = -1

Query: 583 HNRLTVPSQSNRQTVTL---FPHNTRTVRS 503
           HN +T P+Q    T+T+   + HNT T+ S
Sbjct: 138 HNTITTPTQYQHNTITIPSQYHHNTITIPS 167


>SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1741

 Score = 31.1 bits (67), Expect = 0.71
 Identities = 20/48 (41%), Positives = 25/48 (52%)
 Frame = -3

Query: 272 WNSARGRLVTAATGSMGPADGALLLSPSRKHFLFICVEPGSTPRCPSG 129
           W  AR  LV A T ++ PAD +L+ SPSR      CV    T  C +G
Sbjct: 745 WGRAR-TLVFAWTYNVNPADASLIASPSRS-----CVHGNVTLTCTAG 786


>SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58)
          Length = 429

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = -3

Query: 281 VGMWNSARGRLVTAATGSMGPADGALLLSPSRKHFLF-ICVEPGSTPRCPSGTPSMSPQK 105
           + + N  RGRL T++ G       +  +S S    L  +   P ++ R P G+ S+SP  
Sbjct: 257 IALNNPLRGRLSTSSLGETFSHSSSRSISVSSVSSLSSVSSSPRTSRRSPPGSGSLSPSV 316

Query: 104 GSPASQP 84
            SP+  P
Sbjct: 317 FSPSPCP 323


>SB_159| Best HMM Match : TP2 (HMM E-Value=0.58)
          Length = 429

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = -3

Query: 281 VGMWNSARGRLVTAATGSMGPADGALLLSPSRKHFLF-ICVEPGSTPRCPSGTPSMSPQK 105
           + + N  RGRL T++ G       +  +S S    L  +   P ++ R P G+ S+SP  
Sbjct: 257 IALNNPLRGRLSTSSLGETFSHSSSRSISVSSVSSLSSVSSSPRTSRRSPPGSGSLSPSV 316

Query: 104 GSPASQP 84
            SP+  P
Sbjct: 317 FSPSPCP 323


>SB_46216| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 467 LPALMSFXTTRTHPKAXKQKFRMWKQIKLNH 375
           LP  M   T +T PK   Q FR +KQ++  H
Sbjct: 40  LPPNMRLQTPKTGPKGVIQDFRRYKQLETEH 70


>SB_16839| Best HMM Match : zf-GRF (HMM E-Value=3.7e-15)
          Length = 333

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 13/36 (36%), Positives = 24/36 (66%)
 Frame = -3

Query: 203 LLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSP 96
           L++P  K+F++ CV PG++ R P+  PS++    +P
Sbjct: 207 LVAPITKYFIYGCVTPGAS-RTPTLVPSINGGNTTP 241


>SB_26078| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.45)
          Length = 671

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -3

Query: 164 VEPGSTPRCPSGTPSMSPQKGSPASQPYT 78
           + P S P  PS +P+ +   GSP  QP++
Sbjct: 77  LNPTSDPEIPSSSPNDNHLPGSPGEQPFS 105


>SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 511

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 18/58 (31%), Positives = 25/58 (43%)
 Frame = -3

Query: 269 NSARGRLVTAATGSMGPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSP 96
           +S   RL+  +TG+ G A    + S + KH       P S P  P   PS    +G P
Sbjct: 257 DSVSSRLINRSTGNSGTASPTFITSSANKHAQL----PPSAPASPK--PSTPSSEGMP 308


>SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3112

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 1/40 (2%)
 Frame = +3

Query: 435 SSGXKRHQCGQFPLYNWTLSKQKLRTVR-VLCGNRVTVCL 551
           S G K   C   PLY+WT++     T+    C +  T CL
Sbjct: 130 SCGAKNRTCTLQPLYDWTIASNNSVTLSGSSCNSGETYCL 169


>SB_31861| Best HMM Match : rve (HMM E-Value=3.6e-07)
          Length = 1253

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 15/46 (32%), Positives = 20/46 (43%)
 Frame = -3

Query: 146 PRCPSGTPSMSPQKGSPASQPYTLXRN*TVAAVSSRRNSPHTQKRV 9
           P    G    SP +GSP    + L R     +  +RR+ PH Q  V
Sbjct: 359 PHLLQGRMEASPLQGSPQVTNHNLARTKGQTSEGNRRHHPHIQAAV 404


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,995,845
Number of Sequences: 59808
Number of extensions: 396823
Number of successful extensions: 1069
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 960
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1062
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1439498375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).