SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0027
         (429 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_49081| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   2.9  
SB_22475| Best HMM Match : Peptidase_A17 (HMM E-Value=3e-11)           27   8.7  

>SB_49081| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 175

 Score = 28.3 bits (60), Expect = 2.9
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = -1

Query: 192 DAVTDVPAHFFNFLEDLPPGLGSSTGHAQSQHQSED 85
           D + D P H  + L+ L  GLG + GH+ S  Q+ D
Sbjct: 113 DGLGDTPGHSDSHLQTLD-GLGDTPGHSDSHPQTLD 147


>SB_22475| Best HMM Match : Peptidase_A17 (HMM E-Value=3e-11)
          Length = 646

 Score = 26.6 bits (56), Expect = 8.7
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -2

Query: 173 LPIFSIFLKIFHLGSGAALVMLKASTRAKT 84
           L I S+FL I  LG+G+ LV+LK     +T
Sbjct: 26  LTIVSLFLVISVLGNGSILVLLKRFKSLRT 55


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,776,406
Number of Sequences: 59808
Number of extensions: 219480
Number of successful extensions: 393
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 379
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 392
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 826502419
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).