SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0026
         (399 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0)                   28   2.4  
SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15)                   28   3.2  
SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15)               27   4.3  
SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7)                  27   5.6  

>SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 203

 Score = 28.3 bits (60), Expect = 2.4
 Identities = 11/40 (27%), Positives = 22/40 (55%)
 Frame = +1

Query: 106 CCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRK 225
           C  ++H G+++ I   + R Q+ G+  R    C TS+ ++
Sbjct: 6   CATVFHDGAMNPIEVIKQRLQMYGSPYRGVIHCATSVFKE 45


>SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15)
          Length = 594

 Score = 27.9 bits (59), Expect = 3.2
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +1

Query: 118 WHWGSVDSISGSRARFQLSGNSGRKHSR 201
           WH  S +S++G R R+ +S  S   H+R
Sbjct: 20  WHCYSEESLTGDRRRYNISKQSTLYHTR 47


>SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15)
          Length = 378

 Score = 27.5 bits (58), Expect = 4.3
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = +1

Query: 118 WHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILR 222
           + W  VDSI+ S+A+F  S  +   H    T  LR
Sbjct: 265 YEWPLVDSITASKAKFYFSCATNENHKEQGTVCLR 299


>SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7)
          Length = 534

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%)
 Frame = -2

Query: 158 AREPL-MESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAI 33
           +REP    S  PQ H+L  +R  L + ++   CS   CS+  I
Sbjct: 57  SREPFDSRSKLPQKHLLNSKRRALAIAKILLACSPEHCSMSFI 99


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,245,553
Number of Sequences: 59808
Number of extensions: 196880
Number of successful extensions: 340
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 336
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 340
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 703143849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).