SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0025
         (598 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_9743| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.53 
SB_10512| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.2  
SB_57782| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1)                    29   3.8  
SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.0  
SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_16907| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_41099| Best HMM Match : VWA (HMM E-Value=0)                         27   8.7  
SB_26228| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.7  
SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.7  
SB_35270| Best HMM Match : Jacalin (HMM E-Value=8.6)                   27   8.7  
SB_24494| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.7  
SB_23919| Best HMM Match : Nanovirus_C8 (HMM E-Value=7.2)              27   8.7  

>SB_9743| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 13/37 (35%), Positives = 22/37 (59%)
 Frame = +2

Query: 470 NERHPADTGRWRAQGQASPGIFNSRGAADGSDISSRR 580
           N +  AD G +  +G+A  G+FN +G AD    +++R
Sbjct: 70  NNKGVADKGLFNNKGEADKGLFNDKGEADKGLFNNKR 106



 Score = 28.3 bits (60), Expect = 5.0
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +2

Query: 470 NERHPADTGRWRAQGQASPGIFNSRGAAD 556
           N +  AD G +  +G+A  G+FN++  AD
Sbjct: 81  NNKGEADKGLFNDKGEADKGLFNNKRVAD 109


>SB_10512| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 10/35 (28%), Positives = 16/35 (45%)
 Frame = +3

Query: 252 CGCRKPKIPENALECHEYIEDENVEFPTCCARLRC 356
           C  +KP +P++    HE +    +    C  R RC
Sbjct: 28  CLAQKPGVPQDTRHSHEPLPQRKISLIVCSTRTRC 62


>SB_57782| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 310

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -3

Query: 119 SADRAGKTRQHNINNAPNCFPCCIL 45
           SA+   K R H+  N  +CF CCIL
Sbjct: 279 SANDKKKKRLHDSANQKSCFTCCIL 303


>SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1)
          Length = 1188

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = +3

Query: 270 KIPENALECHEYIEDENVEFPT 335
           ++ E+ LEC EYI ++N EF T
Sbjct: 513 EMSESILECFEYIPEKNTEFMT 534


>SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1981

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 14/39 (35%), Positives = 16/39 (41%)
 Frame = +3

Query: 225 QRREILHSCCGCRKPKIPENALECHEYIEDENVEFPTCC 341
           QRRE   +  G    K  E     H+   D NV F  CC
Sbjct: 731 QRREGFKTAEGSEARKQDERRFRLHQSSSDSNVYFSQCC 769


>SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1593

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = +1

Query: 214 RCEIRDGKYFIAAVDVENQKYRKTHWNATNTSK 312
           +C I  G+Y+I     + Q++R   WNA +T++
Sbjct: 497 QCNIIHGRYYIFHHKKDVQRHRYLVWNANDTTR 529


>SB_16907| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 886

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%)
 Frame = +3

Query: 399 QPGELF-PDKPWKGQQNEPNP 458
           QP ELF P+ P K QQN+P P
Sbjct: 121 QPVELFAPNSPPKPQQNQPKP 141


>SB_41099| Best HMM Match : VWA (HMM E-Value=0)
          Length = 3373

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 15/38 (39%), Positives = 17/38 (44%)
 Frame = +2

Query: 335  VLCAIALRRRSKWRENSANQRAAWRTVPR*TMEGPTKR 448
            V C     R    RE     RA WR+VP  +   PTKR
Sbjct: 3168 VACLQVFARVLNAREIQQRMRACWRSVPTKSPVVPTKR 3205


>SB_26228| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1128

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%)
 Frame = +2

Query: 248 LLWMSKTKNTGKRTGM--PRIHRR*ECRIPHVLCAIALRRRSKWRENS 385
           L W  + KN GKR G+  P  + R  C    +   +A R R  WREN+
Sbjct: 17  LSWNPEYKNPGKRNGIRNPEPYWR-SCH-EAMTYPLATRHRQIWRENA 62


>SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 13/33 (39%), Positives = 15/33 (45%)
 Frame = -1

Query: 487 CWMPLIPTTAGFGSFCWPFHGLSGNSSPGCPLV 389
           CW       A    +CWP    S + SPG PLV
Sbjct: 26  CWPKGREFLAKRARYCWPKDIASNSCSPGDPLV 58


>SB_35270| Best HMM Match : Jacalin (HMM E-Value=8.6)
          Length = 211

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/27 (40%), Positives = 14/27 (51%)
 Frame = +1

Query: 121 DVSYQACVDKYSRKGYQPWQEWSDHYT 201
           D SY    D+    GY  WQ W+D +T
Sbjct: 144 DGSYPKPHDEALEAGYDSWQAWADAWT 170


>SB_24494| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 518

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +2

Query: 272 NTGKRTGMPRIHRR*ECRIPHVLCAIA 352
           + GK  G   IH R +CR P  LC +A
Sbjct: 373 SNGKLMGTIDIHSRRKCRNPRSLCVVA 399


>SB_23919| Best HMM Match : Nanovirus_C8 (HMM E-Value=7.2)
          Length = 308

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 9/25 (36%), Positives = 15/25 (60%)
 Frame = +3

Query: 216 MRDQRREILHSCCGCRKPKIPENAL 290
           MR++R  I+ +C  C  P  P+N +
Sbjct: 1   MRERRENIVRACENCETPSSPKNTM 25


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,591,127
Number of Sequences: 59808
Number of extensions: 465583
Number of successful extensions: 1361
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1221
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1361
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1439498375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).