SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0024
         (439 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_11360| Best HMM Match : PDZ (HMM E-Value=0)                         27   6.8  
SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.9  
SB_22475| Best HMM Match : Peptidase_A17 (HMM E-Value=3e-11)           27   8.9  
SB_20258| Best HMM Match : Exo_endo_phos (HMM E-Value=7.1e-16)         27   8.9  
SB_17758| Best HMM Match : Transformer (HMM E-Value=0.35)              27   8.9  
SB_42532| Best HMM Match : Exo_endo_phos (HMM E-Value=7.2e-16)         27   8.9  
SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.9  

>SB_11360| Best HMM Match : PDZ (HMM E-Value=0)
          Length = 625

 Score = 27.1 bits (57), Expect = 6.8
 Identities = 14/38 (36%), Positives = 19/38 (50%)
 Frame = -1

Query: 241 RLFSYGFSRTEDLDRRARFDDAVTNVPAHFFNFLEDLP 128
           R+ S  F+RT D   R  F+D   +V    F F + LP
Sbjct: 369 RMKSVKFTRTSDDKLRGSFNDGTGSVRKRSFKFSKKLP 406


>SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2362

 Score = 26.6 bits (56), Expect = 8.9
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = -1

Query: 262  VFMRTF*RLFSYGFSRTEDLDRRARFDDAVTNVPAHFFNFLEDLPPGL 119
            VF +   R+  Y   +  D D    F+D + NVP H  N ++D+   L
Sbjct: 1864 VFTKAKPRMLEYRSYKNFDADS---FNDDLRNVPWHIVNSMDDIDDAL 1908


>SB_22475| Best HMM Match : Peptidase_A17 (HMM E-Value=3e-11)
          Length = 646

 Score = 26.6 bits (56), Expect = 8.9
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -2

Query: 162 LPIFSIFLKIFHLGSGAALVMLKASTRAKT 73
           L I S+FL I  LG+G+ LV+LK     +T
Sbjct: 26  LTIVSLFLVISVLGNGSILVLLKRFKSLRT 55


>SB_20258| Best HMM Match : Exo_endo_phos (HMM E-Value=7.1e-16)
          Length = 525

 Score = 26.6 bits (56), Expect = 8.9
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = -1

Query: 262 VFMRTF*RLFSYGFSRTEDLDRRARFDDAVTNVPAHFFNFLEDLPPGL 119
           VF +   R+  Y   +  D D    F+D + NVP H  N ++D+   L
Sbjct: 264 VFTKAKPRMLEYRSYKNFDADS---FNDDLRNVPWHIVNSMDDIDDAL 308


>SB_17758| Best HMM Match : Transformer (HMM E-Value=0.35)
          Length = 974

 Score = 26.6 bits (56), Expect = 8.9
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = -1

Query: 256 MRTF*RLFSYGFSRTEDLDRRARFDDAVTN 167
           ++TF R+ +YG    ED+D +  + D+ TN
Sbjct: 587 LKTF-RVLNYGAKSREDVDSKVSYSDSGTN 615


>SB_42532| Best HMM Match : Exo_endo_phos (HMM E-Value=7.2e-16)
          Length = 399

 Score = 26.6 bits (56), Expect = 8.9
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = -1

Query: 262 VFMRTF*RLFSYGFSRTEDLDRRARFDDAVTNVPAHFFNFLEDLPPGL 119
           VF +   R+  Y   +  D D    F+D + NVP H  N ++D+   L
Sbjct: 264 VFTKAKPRMLEYRSYKNFDADS---FNDDLRNVPWHIVNSMDDIDDAL 308


>SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1182

 Score = 26.6 bits (56), Expect = 8.9
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = -1

Query: 262 VFMRTF*RLFSYGFSRTEDLDRRARFDDAVTNVPAHFFNFLEDLPPGL 119
           VF +   R+  Y   +  D D    F+D + NVP H  N ++D+   L
Sbjct: 138 VFTKAKPRMLEYRSYKNLDADS---FNDDLRNVPWHIVNSMDDIDDAL 182


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,785,351
Number of Sequences: 59808
Number of extensions: 165439
Number of successful extensions: 302
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 285
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 302
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 847047381
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).