SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0023
         (289 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_48154| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.27 
SB_51975| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   0.83 
SB_23131| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   1.1  
SB_7587| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-13)                28   1.1  
SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   1.9  
SB_59058| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   1.9  
SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1)                      27   1.9  
SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17)                26   4.4  
SB_148| Best HMM Match : PRKCSH (HMM E-Value=2.4)                      26   4.4  
SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     26   5.8  
SB_39407| Best HMM Match : TIG (HMM E-Value=0)                         26   5.8  
SB_40233| Best HMM Match : Ion_trans_2 (HMM E-Value=1.4e-23)           25   7.7  
SB_33036| Best HMM Match : Ion_trans_2 (HMM E-Value=3e-08)             25   7.7  
SB_23062| Best HMM Match : No HMM Matches (HMM E-Value=.)              25   7.7  

>SB_48154| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 367

 Score = 30.3 bits (65), Expect = 0.27
 Identities = 13/49 (26%), Positives = 21/49 (42%), Gaps = 2/49 (4%)
 Frame = +2

Query: 125 HAKYTCSFCGKDAMKRSCVGIWSCKRCK--RTVAGGAWVFSTTAAYHAD 265
           HA Y CS   ++ +K +    +     K  R +    WV  T + YH +
Sbjct: 64  HASYLCSLKRRELLKPNIAQAYQAHHIKNWRKITSDPWVLETASGYHLE 112


>SB_51975| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 809

 Score = 28.7 bits (61), Expect = 0.83
 Identities = 10/25 (40%), Positives = 13/25 (52%)
 Frame = +1

Query: 13  EVYQNGQTYQKGWNYWQIWHTLRCL 87
           + YQ     + GW  WQIW  LR +
Sbjct: 644 DTYQGRPLMKYGWLKWQIWRALRLI 668


>SB_23131| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 91

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +2

Query: 38  TKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTC 142
           T+  GIT    T Y +S +K+V +   T+ A  TC
Sbjct: 19  TRWSGITCMMSTHYSSSYKKLVPRQLTTRWASITC 53


>SB_7587| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-13)
          Length = 351

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +2

Query: 80  GASLRKMVKKMEVTQHAKYTCSFCGK 157
           G   +K ++  E++ H KY CS CGK
Sbjct: 210 GGVTKKQIQSNEIS-HKKYVCSTCGK 234


>SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 604

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 12/22 (54%), Positives = 14/22 (63%)
 Frame = -2

Query: 159 SLPQNEQVYFACWVTSIFLTIL 94
           S P +  V FA W  SIFLTI+
Sbjct: 133 SAPTSLSVIFAAWFLSIFLTII 154


>SB_59058| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 377

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 9/31 (29%), Positives = 18/31 (58%)
 Frame = -2

Query: 177 QERFIASLPQNEQVYFACWVTSIFLTILRRE 85
           +++  AS  + E  ++ CWV S F+T  + +
Sbjct: 167 RKKIAASCWEKESEFYECWVASFFITTAKTQ 197


>SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1)
          Length = 298

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = +2

Query: 137 TCSFCGKDAMKRS 175
           TC+FCGKDA K S
Sbjct: 243 TCNFCGKDARKTS 255


>SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17)
          Length = 815

 Score = 26.2 bits (55), Expect = 4.4
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = +1

Query: 13  EVYQNGQTYQKGWNYWQIWHTLRCL 87
           +VY+N    + G   WQIW  LR +
Sbjct: 643 DVYRNEPLQRYGMLKWQIWRALRLI 667


>SB_148| Best HMM Match : PRKCSH (HMM E-Value=2.4)
          Length = 438

 Score = 26.2 bits (55), Expect = 4.4
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = -3

Query: 230 KLLLLQSSCIAYKTRCRHKNVS*HPYHKMSKYTLRVGL 117
           +++ LQS    YK  C  KNV  HP      Y LR+GL
Sbjct: 110 RVVTLQSDSYPYK--CYIKNVLSHPQESQESY-LRLGL 144


>SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 618

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = +2

Query: 92  RKMVKKMEVTQHAKYTCSFCGKDAMKRS 175
           R+ VK + + +  KY C  C KD  + S
Sbjct: 410 REQVKDLFIKEGEKYRCRLCSKDFTRLS 437


>SB_39407| Best HMM Match : TIG (HMM E-Value=0)
          Length = 1710

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 15/51 (29%), Positives = 22/51 (43%)
 Frame = +2

Query: 5    VSERFTKMAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGK 157
            +S  +TK+  RT+K  I GKY       +++      V     YT S   K
Sbjct: 1245 MSSSYTKIICRTQKSHIPGKYNVSVSVGVQQCACTSHVGCSFAYTTSLTPK 1295


>SB_40233| Best HMM Match : Ion_trans_2 (HMM E-Value=1.4e-23)
          Length = 750

 Score = 25.4 bits (53), Expect = 7.7
 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = +2

Query: 176 CVGIWSCKRCKRTVAGG--AWVFSTTAAYHADLLSGGYVK 289
           C+G W     + T   G  AW  + T   + D++ GG+ K
Sbjct: 620 CIGAWIYTNEEGTYLEGTYAWFITFTTIGYGDIVPGGHSK 659


>SB_33036| Best HMM Match : Ion_trans_2 (HMM E-Value=3e-08)
          Length = 298

 Score = 25.4 bits (53), Expect = 7.7
 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = +2

Query: 176 CVGIWSCKRCKRTVAGG--AWVFSTTAAYHADLLSGGYVK 289
           C+G W     + T   G  AW  + T   + D++ GG+ K
Sbjct: 168 CIGAWIYTNEEGTYLEGTYAWFITFTTIGYGDIVPGGHSK 207


>SB_23062| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 725

 Score = 25.4 bits (53), Expect = 7.7
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = +1

Query: 13  EVYQNGQTYQKGWNYWQIWHTLRCL 87
           +VYQ  +  + G   WQIW  LR +
Sbjct: 558 DVYQVNKLQKFGMLKWQIWRALRLI 582


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,226,946
Number of Sequences: 59808
Number of extensions: 209695
Number of successful extensions: 595
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 569
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 595
length of database: 16,821,457
effective HSP length: 70
effective length of database: 12,634,897
effective search space used: 315872425
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).