SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0020
         (598 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0)                29   2.2  
SB_43814| Best HMM Match : RRM_1 (HMM E-Value=1.3)                     29   3.8  
SB_43937| Best HMM Match : Lipoprotein_17 (HMM E-Value=8.4)            29   3.8  
SB_10201| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.8  

>SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0)
          Length = 1831

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 11/17 (64%), Positives = 13/17 (76%)
 Frame = +3

Query: 312  NYVEKNKYDNIVVLDHS 362
            NY EKN+Y NI+  DHS
Sbjct: 1065 NYREKNRYANIIAYDHS 1081


>SB_43814| Best HMM Match : RRM_1 (HMM E-Value=1.3)
          Length = 642

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 13/42 (30%), Positives = 26/42 (61%)
 Frame = +3

Query: 300 QKTYNYVEKNKYDNIVVLDHSFALGMFKQSIYNQTMLLFTKS 425
           Q+ + ++ ++K +N+ + D  F L +FK+S+Y +T   F  S
Sbjct: 452 QQLWRWLHESK-NNVNLADRPFILNLFKKSLYAETEQEFENS 492


>SB_43937| Best HMM Match : Lipoprotein_17 (HMM E-Value=8.4)
          Length = 311

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 13/42 (30%), Positives = 26/42 (61%)
 Frame = +3

Query: 300 QKTYNYVEKNKYDNIVVLDHSFALGMFKQSIYNQTMLLFTKS 425
           Q+ + ++ ++K +N+ + D  F L +FK+S+Y +T   F  S
Sbjct: 115 QQLWRWLHESK-NNVNLADRPFILNLFKKSLYAETEQEFENS 155


>SB_10201| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1162

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 13/42 (30%), Positives = 26/42 (61%)
 Frame = +3

Query: 300 QKTYNYVEKNKYDNIVVLDHSFALGMFKQSIYNQTMLLFTKS 425
           Q+ + ++ ++K +N+ + D  F L +FK+S+Y +T   F  S
Sbjct: 510 QQLWRWLHESK-NNVNLADRPFILNLFKKSLYAETEQEFENS 550


>SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1113

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 13/42 (30%), Positives = 26/42 (61%)
 Frame = +3

Query: 300 QKTYNYVEKNKYDNIVVLDHSFALGMFKQSIYNQTMLLFTKS 425
           Q+ + ++ ++K +N+ + D  F L +FK+S+Y +T   F  S
Sbjct: 607 QQLWRWLHESK-NNVNLADRPFILNLFKKSLYAETEQEFENS 647


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,917,609
Number of Sequences: 59808
Number of extensions: 254110
Number of successful extensions: 506
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 481
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 506
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1439498375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).