SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0018
         (678 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_24887| Best HMM Match : PspA_IM30 (HMM E-Value=0.19)                33   0.21 
SB_22720| Best HMM Match : KID (HMM E-Value=0.0014)                    33   0.28 
SB_44228| Best HMM Match : LMP (HMM E-Value=0.11)                      31   0.86 
SB_20999| Best HMM Match : Mod_r (HMM E-Value=0.042)                   31   0.86 
SB_26831| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.5  
SB_24118| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.0  
SB_56834| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_24697| Best HMM Match : Filament (HMM E-Value=0.11)                 29   3.5  
SB_56158| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_53578| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_5914| Best HMM Match : 7tm_1 (HMM E-Value=4.5e-18)                  29   3.5  
SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018)                    29   4.6  
SB_44562| Best HMM Match : 7tm_1 (HMM E-Value=9e-12)                   28   6.0  
SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.0  
SB_3697| Best HMM Match : Mucin (HMM E-Value=4.2)                      28   6.0  
SB_7782| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   6.0  
SB_3285| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   6.0  
SB_48933| Best HMM Match : Drf_FH1 (HMM E-Value=1.4)                   28   8.0  
SB_3786| Best HMM Match : THAP (HMM E-Value=7.5e-07)                   28   8.0  
SB_15723| Best HMM Match : DUF1639 (HMM E-Value=1.7)                   28   8.0  

>SB_24887| Best HMM Match : PspA_IM30 (HMM E-Value=0.19)
          Length = 320

 Score = 33.1 bits (72), Expect = 0.21
 Identities = 22/86 (25%), Positives = 40/86 (46%)
 Frame = +3

Query: 54  QRARHTDALQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLD 233
           ++ +H   LQR +       ++ DKL+D V+   + +  L T      +  +   ES+L+
Sbjct: 73  EKDKHNRQLQRSVDKLNELLEEADKLKDVVSQKDEKIAVLSTN-HDFKEKQLRETESRLE 131

Query: 234 DWRVPFKRLHQYSTKKQKEIHALFPR 311
           D++   K+L      K K+I  L  R
Sbjct: 132 DFKNEVKKLQHTIKLKDKKIDGLESR 157


>SB_22720| Best HMM Match : KID (HMM E-Value=0.0014)
          Length = 847

 Score = 32.7 bits (71), Expect = 0.28
 Identities = 21/83 (25%), Positives = 39/83 (46%)
 Frame = +3

Query: 54  QRARHTDALQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLD 233
           ++ +H   LQR +       ++ DKL+D V+   + +  L T      +  +   ES+L+
Sbjct: 78  EKDKHNRQLQRSVDKLNELLEEADKLKDVVSQKDEKIAVLSTN-HDFKEKQLRETESRLE 136

Query: 234 DWRVPFKRLHQYSTKKQKEIHAL 302
           D++   K+L      K K+I  L
Sbjct: 137 DFKNEVKKLQHTIKLKDKKIDGL 159


>SB_44228| Best HMM Match : LMP (HMM E-Value=0.11)
          Length = 276

 Score = 31.1 bits (67), Expect = 0.86
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = +3

Query: 54  QRARHTDALQRIMISFKHFEKKL-DKLQDDVNDHGKTLGDLKTMVSKLSQNTV 209
           QR RH+D +QRI    +H   KL  K++   ++  + + DL+  + K ++ +V
Sbjct: 198 QRQRHSDEIQRISAEHEHQCAKLSQKIESLSSEQEEAIQDLEKQLKKANKESV 250


>SB_20999| Best HMM Match : Mod_r (HMM E-Value=0.042)
          Length = 193

 Score = 31.1 bits (67), Expect = 0.86
 Identities = 21/83 (25%), Positives = 38/83 (45%)
 Frame = +3

Query: 54  QRARHTDALQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLD 233
           ++ +H   LQR +       ++ DKL+D V+   + +  L T      +  +   ES+L+
Sbjct: 73  EKDKHNRQLQRSVDELNELLEEADKLKDVVSQKDEKIAVLSTN-HDFKEKQLRETESRLE 131

Query: 234 DWRVPFKRLHQYSTKKQKEIHAL 302
           D +   K+L      K K+I  L
Sbjct: 132 DSKNEVKKLQHTIKLKDKKIDGL 154


>SB_26831| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 932

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 4/89 (4%)
 Frame = +3

Query: 57  RARHTDA-LQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLS---QNTVIGPES 224
           R+ H +A L+    S K   +K + LQ+D+    + LG++K  +S+ +   Q+     E 
Sbjct: 644 RSEHAEAALKDDKNSVKQLNEKNETLQNDLASRMEELGEVKRKLSETTDALQHETSAAEQ 703

Query: 225 KLDDWRVPFKRLHQYSTKKQKEIHALFPR 311
           KL       +     ++ K KEI  L  R
Sbjct: 704 KLASLAAKLEEAFVANSAKTKEIEELTSR 732


>SB_24118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1067

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 22/101 (21%), Positives = 48/101 (47%), Gaps = 1/101 (0%)
 Frame = +3

Query: 54  QRARHTDA-LQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKL 230
           QR  H D    ++ ++ K  +++L K+   VNDH K  G+   +       T +G +  L
Sbjct: 377 QRQGHQDDDSNKVEVNAKRLQEELIKMA--VNDHSKQPGNENLVTEPTQDLTGVGRDGVL 434

Query: 231 DDWRVPFKRLHQYSTKKQKEIHALFPRERKTYSHCQLNQKL 353
                P++ + Q S + ++  ++   ++++T    Q  Q++
Sbjct: 435 GTTVSPWQHVTQ-SAQAERTTYSYLSQQQQTQPTQQQQQQI 474


>SB_56834| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 552

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 14/55 (25%), Positives = 26/55 (47%)
 Frame = +3

Query: 138 DVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKRLHQYSTKKQKEIHAL 302
           D  D+ +   D  T+  K  +N    PE  + D R+ F     Y+T+ +  I+++
Sbjct: 124 DYTDYVEQPMDFSTVWRKFVENQYSDPEQLVSDIRLVFSNSRAYNTQPRSRIYSM 178


>SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2520

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 3/91 (3%)
 Frame = +3

Query: 84   RIMISFKHFEKKLD-KLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLD--DWRVPFK 254
            RI+      +K+LD ++ + V +H   L DL+T   K  +  +   ES+++  D R+   
Sbjct: 1062 RILXXXXSVKKELDCRIMEMVENHRHELDDLRTQAEKRLEELIQQHESEMEGVDSRIQQA 1121

Query: 255  RLHQYSTKKQKEIHALFPRERKTYSHCQLNQ 347
            RL   S    KEI     RE +   +   N+
Sbjct: 1122 RLE--SENNFKEILETHQREMEEIRNSHENK 1150


>SB_24697| Best HMM Match : Filament (HMM E-Value=0.11)
          Length = 266

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 6/67 (8%)
 Frame = +3

Query: 111 EKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNT------VIGPESKLDDWRVPFKRLHQYS 272
           EK L++ + +     KT+ DLK   S+L QN       +I  E+KL+  ++   +LH+ S
Sbjct: 75  EKALEQSRKEGAKKDKTIEDLKNKNSELEQNVQNLNNEIIKLEAKLEALQLENNKLHEDS 134

Query: 273 TKKQKEI 293
            + ++ I
Sbjct: 135 LEVKRTI 141


>SB_56158| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 212

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 20/85 (23%), Positives = 37/85 (43%)
 Frame = +2

Query: 221 KQARRLEGTFQASASVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPIS 400
           K A +         S +    +R   S+P RK+   PLP     K+L  + +   +   S
Sbjct: 103 KPAAKKPAAKSPQQSPRRSRQRRRHQSLP-RKQQRNPLPKNLLPKNLLPRKLQNPSLQRS 161

Query: 401 VPPKIIRKRSPRTRKVETPRKTPTL 475
            PP+ +R++ P    ++ P ++  L
Sbjct: 162 QPPRNLRRKPPPRSPLKRPPRSKVL 186


>SB_53578| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1430

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 21/71 (29%), Positives = 35/71 (49%)
 Frame = +2

Query: 284  KRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRK 463
            KR  C     +K +Q +    K+K L+ Q+ I+    +S PP ++ KR   T +VET   
Sbjct: 1184 KRTKCKSSSPRK-LQKITTPEKSK-LETQSPIKVDVSLS-PPALVIKRQNNTWQVETKEH 1240

Query: 464  TPTLRSHKGLE 496
              +  + K L+
Sbjct: 1241 ETSTTTTKRLQ 1251


>SB_5914| Best HMM Match : 7tm_1 (HMM E-Value=4.5e-18)
          Length = 327

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 10/41 (24%), Positives = 21/41 (51%)
 Frame = -3

Query: 208 TVFCESLLTIVLRSPKVLPWSFTSSCNLSSFFSKCLKEIII 86
           T FC S++ +         WS  + C++ +F + C+  +I+
Sbjct: 238 TPFCVSVVMVAAMGESAKSWSAEALCSVIAFTNACMNPVIL 278


>SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018)
          Length = 843

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 4/37 (10%)
 Frame = +3

Query: 114 KKLDKLQDDVNDHG----KTLGDLKTMVSKLSQNTVI 212
           + L+KLQ  V  HG    K  GD++ M+ ++ Q T+I
Sbjct: 580 RALEKLQASVERHGDKYIKARGDVQRMIEEVKQETII 616


>SB_44562| Best HMM Match : 7tm_1 (HMM E-Value=9e-12)
          Length = 276

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 10/41 (24%), Positives = 21/41 (51%)
 Frame = -3

Query: 208 TVFCESLLTIVLRSPKVLPWSFTSSCNLSSFFSKCLKEIII 86
           T FC S++ +         WS  + C++ +F + C+  +I+
Sbjct: 187 TPFCVSVVMVAAMGESAKSWSAEALCSVIAFTNACVNPLIL 227


>SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1174

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 3/64 (4%)
 Frame = +2

Query: 299 SVPKRKKNIQPLPIKSKAKSLQNQNII---EAAFPISVPPKIIRKRSPRTRKVETPRKTP 469
           S+P  K + Q   +KS++   +++      E A P   PP  +  R+P TR   TP  + 
Sbjct: 557 SIPA-KPSQQRAQLKSESTGSESETETSSEEEAAPTKTPPSTVNSRTPVTRAQSTPSLSS 615

Query: 470 TLRS 481
           ++ S
Sbjct: 616 SVTS 619


>SB_3697| Best HMM Match : Mucin (HMM E-Value=4.2)
          Length = 120

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 410 KIIRKRSPRTRKVETPRKTPTLRSH 484
           K ++KR P TR  + PR T T +SH
Sbjct: 18  KKVQKRGPYTRDDKCPRNTRTAKSH 42


>SB_7782| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 7/82 (8%)
 Frame = +2

Query: 263 SVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSL--QNQNIIEAAFPISVPPKIIR---KR 427
           +V   E   D+ S+  +KKN+   P+K+ A  L    +N +      S+  K +R   K+
Sbjct: 123 TVDSNEESSDTSSLENKKKNLNKYPVKNNADRLLVPPRNDLNDTEEDSLSKKQLREAAKQ 182

Query: 428 SPRTRKV--ETPRKTPTLRSHK 487
             R  K+  ET R+   L   K
Sbjct: 183 KKREEKILLETERRLKKLEKEK 204


>SB_3285| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1437

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 15/50 (30%), Positives = 22/50 (44%)
 Frame = +3

Query: 51   LQRARHTDALQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQ 200
            + R    D L R+ I+F H      +LQD+ N H   + D+      L Q
Sbjct: 1061 ITRKELLDQLSRMRINFFHMAATSTRLQDEDNRHTVAIADMGNYQEVLRQ 1110


>SB_48933| Best HMM Match : Drf_FH1 (HMM E-Value=1.4)
          Length = 611

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 17/68 (25%), Positives = 33/68 (48%), Gaps = 1/68 (1%)
 Frame = +2

Query: 275 EETKRDSCSVPKRKKNIQPLP-IKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVE 451
           ++ K      PK   ++ P+P I + A+  +    I +  P+   P+I   + P T + E
Sbjct: 28  DQPKAIQPETPKDTPSMLPVPEIATPAQQPETPKDIPSMVPV---PEIATSQQPETIQPE 84

Query: 452 TPRKTPTL 475
           TP+  P++
Sbjct: 85  TPKDIPSM 92


>SB_3786| Best HMM Match : THAP (HMM E-Value=7.5e-07)
          Length = 807

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +3

Query: 96  SFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKL 194
           S+K F K LDKL+ +   H KT G + +  S++
Sbjct: 276 SWKSFFKDLDKLKCNCKRHSKTCGCMSSNFSRM 308


>SB_15723| Best HMM Match : DUF1639 (HMM E-Value=1.7)
          Length = 153

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 4/70 (5%)
 Frame = +2

Query: 275 EETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFP----ISVPPKIIRKRSPRTR 442
           E  K  S +  K  KN++  P K K ++L+  +    ++P    +S  PK    +  RTR
Sbjct: 20  EVKKEQSDNARKPDKNLKHNPTK-KTQALKRSSPTSLSYPQKDWLSKKPK---NQDIRTR 75

Query: 443 KVETPRKTPT 472
           K   P KTP+
Sbjct: 76  KTPKPPKTPS 85


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,014,871
Number of Sequences: 59808
Number of extensions: 337797
Number of successful extensions: 1498
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1424
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1497
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1745338465
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).