SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0015
         (598 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_17881| Best HMM Match : Tubulin (HMM E-Value=0)                    182   1e-46
SB_47198| Best HMM Match : Tubulin (HMM E-Value=0)                    182   2e-46
SB_17879| Best HMM Match : Tubulin (HMM E-Value=0)                    179   2e-45
SB_39308| Best HMM Match : Tubulin (HMM E-Value=0)                    161   3e-40
SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27)              137   7e-33
SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.)             102   3e-22
SB_19437| Best HMM Match : Tubulin (HMM E-Value=0)                    101   4e-22
SB_2674| Best HMM Match : Tubulin (HMM E-Value=0)                     101   4e-22
SB_34400| Best HMM Match : Tubulin (HMM E-Value=0)                    100   8e-22
SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.)              99   1e-21
SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   2e-21
SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.)              99   2e-21
SB_2003| Best HMM Match : Tubulin (HMM E-Value=0)                      99   3e-21
SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.)              95   5e-20
SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)              92   3e-19
SB_48961| Best HMM Match : Tubulin (HMM E-Value=0)                     72   4e-13
SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   7e-12
SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0)                   65   4e-11
SB_35594| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_5512| Best HMM Match : Tubulin (HMM E-Value=0)                      60   2e-09
SB_25311| Best HMM Match : Tubulin (HMM E-Value=0)                     59   3e-09
SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24)                53   2e-07
SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44)           49   3e-06
SB_37976| Best HMM Match : Tubulin (HMM E-Value=4.5e-18)               42   5e-04
SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   5e-04
SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32)             41   7e-04
SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.008
SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.93 
SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083)                    30   1.2  
SB_50693| Best HMM Match : C2 (HMM E-Value=0)                          29   2.2  
SB_47545| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_17458| Best HMM Match : Metalloenzyme (HMM E-Value=0.29)            29   2.9  
SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_23752| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_34911| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015)                     28   6.6  
SB_46977| Best HMM Match : Cu_amine_oxid (HMM E-Value=3.9e-09)         27   8.7  
SB_26176| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.7  
SB_46614| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.7  

>SB_17881| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 458

 Score =  182 bits (444), Expect = 1e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 260 INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 319

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 320 TEGAELVDSVLDVVRKEAESCDCLQGF 346



 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 41/45 (91%), Positives = 41/45 (91%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 214 MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 258


>SB_47198| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 446

 Score =  182 bits (443), Expect = 2e-46
 Identities = 81/87 (93%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 41/45 (91%), Positives = 41/45 (91%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>SB_17879| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 446

 Score =  179 bits (435), Expect = 2e-45
 Identities = 78/87 (89%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPR+V++DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRSVLIDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVLDVVRKEAE CDC++ F
Sbjct: 107 TEGAELMDSVLDVVRKEAESCDCIQGF 133



 Score = 90.2 bits (214), Expect = 1e-18
 Identities = 40/45 (88%), Positives = 41/45 (91%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIV +QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVSLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>SB_39308| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 391

 Score =  161 bits (392), Expect = 3e-40
 Identities = 72/77 (93%), Positives = 75/77 (97%)
 Frame = +2

Query: 287 GKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSV 466
           GKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSV
Sbjct: 2   GKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSV 61

Query: 467 LDVVRKEAEGCDCLRVF 517
           LDVVRKEAE CDC++ F
Sbjct: 62  LDVVRKEAESCDCIQGF 78


>SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27)
          Length = 144

 Score =  137 bits (331), Expect = 7e-33
 Identities = 55/77 (71%), Positives = 69/77 (89%)
 Frame = +2

Query: 281 SGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVD 460
           +GG+YVPR+++VDLEPGTMD+VR GP G +FRPDNFV  QSGA NNWAKGHY+EGAEL+D
Sbjct: 11  TGGRYVPRSILVDLEPGTMDAVRGGPLGNMFRPDNFVNSQSGAANNWAKGHYSEGAELID 70

Query: 461 SVLDVVRKEAEGCDCLR 511
           ++ DV+RKEAE CDC++
Sbjct: 71  NIFDVLRKEAENCDCMQ 87


>SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 452

 Score =  102 bits (244), Expect = 3e-22
 Identities = 43/88 (48%), Positives = 62/88 (70%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV  DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGSGKHVPRAVFCDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D+VLD +RK A+GC  L+ F
Sbjct: 108 YTVGKEMIDTVLDRLRKLADGCTGLQGF 135



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 42


>SB_19437| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 885

 Score =  101 bits (242), Expect = 4e-22
 Identities = 45/88 (51%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  V G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLVTGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTVGKEIVDLVLDRIRKLADQCTGLQGF 135



 Score =  101 bits (241), Expect = 6e-22
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 481 SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 540

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 541 YTVGKEIVDLVLDRIRKLADQCTGLQGF 568



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 435 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 475


>SB_2674| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 1036

 Score =  101 bits (242), Expect = 4e-22
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 633 SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 692

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G EL+D VLD +RK A+ C  L+ F
Sbjct: 693 YTVGKELIDLVLDRIRKLADQCTGLQGF 720



 Score =  100 bits (240), Expect = 8e-22
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 112 SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 171

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 172 YTIGKEIVDLVLDRIRKLADQCTGLQGF 199



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 15/31 (48%), Positives = 21/31 (67%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSV 346
           S N +++E   GK+VPRAV VDLEP   + +
Sbjct: 560 SFNTFFSETGAGKHVPRAVFVDLEPTVRECI 590



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 16/43 (37%), Positives = 21/43 (48%)
 Frame = +3

Query: 117 IMREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           + RE + +  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 64  LQRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 106



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 17/42 (40%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           +RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 586 VRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 627



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 514 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 554


>SB_34400| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 380

 Score =  100 bits (240), Expect = 8e-22
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 47  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 106

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 107 YTVGKEIIDLVLDRIRKLADQCTGLQGF 134



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 41


>SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 112

 Score =   99 bits (238), Expect = 1e-21
 Identities = 43/46 (93%), Positives = 46/46 (100%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 394
           INVYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVF
Sbjct: 47  INVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVF 92



 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 41/45 (91%), Positives = 41/45 (91%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 865

 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 41/88 (46%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D +R+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 466 SFNTFFSETGAGKHVPRAVFVDLEPSVIDEIRTGTYRQLFHPEQLITGKEDAANNYARGH 525

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G + +D+VLD +RK A+ C  L+ F
Sbjct: 526 YTVGKDHIDNVLDRIRKLADQCSGLQGF 553



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 41/88 (46%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV  DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 33  SFNTFFSETGAGKHVPRAVFCDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 92

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G +L++ VLD +RK A+ C  L+ F
Sbjct: 93  YTVGKQLIEIVLDRLRKLADQCTGLQGF 120



 Score = 35.9 bits (79), Expect = 0.025
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           RE V I  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 420 RECVSIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 460


>SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1231

 Score = 99.1 bits (236), Expect = 2e-21
 Identities = 43/88 (48%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           + N ++ E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 419 AFNTFFAETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 478

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E +D VLD +RK A+GC  L+ F
Sbjct: 479 YTVGKEQIDIVLDRLRKLADGCTGLQGF 506



 Score = 99.1 bits (236), Expect = 2e-21
 Identities = 42/88 (47%), Positives = 60/88 (68%)
 Frame = +2

Query: 254  SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
            S N +++E   GK+VPRAV  DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 852  SFNTFFSETGAGKHVPRAVFADLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 911

Query: 434  YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
            YT G E++D VLD +RK A+ C  L+ F
Sbjct: 912  YTVGKEMIDLVLDRIRKLADQCTGLQGF 939



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 373 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 413



 Score = 35.1 bits (77), Expect = 0.043
 Identities = 15/41 (36%), Positives = 20/41 (48%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           RE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 806 RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 846


>SB_2003| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 451

 Score = 98.7 bits (235), Expect = 3e-21
 Identities = 43/88 (48%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD  RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRCRKLADQCTGLQGF 135



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 17/42 (40%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 42


>SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 417

 Score = 94.7 bits (225), Expect = 5e-20
 Identities = 41/88 (46%), Positives = 58/88 (65%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N ++ E   GK+VPRAV VDLEP  +D +R+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 13  SFNTFFAETGAGKHVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLLSGKEDAANNYARGH 72

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E +D  LD +RK A+ C  L+ F
Sbjct: 73  YTVGKEHIDLALDRIRKLADQCTGLQGF 100


>SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1383

 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 39/82 (47%), Positives = 58/82 (70%)
 Frame = +2

Query: 272  NEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAE 451
            +EA+ GKYVPRAV+VDLEP  +D VR+G +  ++ P+  + G+  A NN+A+GHYT G E
Sbjct: 965  SEAAAGKYVPRAVLVDLEPTVIDEVRTGMYRYLYHPEQMISGKEDAANNYARGHYTIGKE 1024

Query: 452  LVDSVLDVVRKEAEGCDCLRVF 517
            +V+ V+D +RK  + C  L+ F
Sbjct: 1025 MVEVVMDKIRKMTDQCSGLQGF 1046


>SB_48961| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 536

 Score = 71.7 bits (168), Expect = 4e-13
 Identities = 37/88 (42%), Positives = 51/88 (57%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +             P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVV----------ALSPEQLITGKEDAANNYARGH 97

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G + VD VLD +RK A+ C  L+ F
Sbjct: 98  YTIGKQQVDQVLDRLRKLADQCSGLQGF 125



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 389

 Score = 67.7 bits (158), Expect = 7e-12
 Identities = 29/60 (48%), Positives = 41/60 (68%)
 Frame = +2

Query: 338 DSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           D VR+G + Q+F P+  + G+  A NN+A+GHYT G EL+D VLD +RK A+ C  L+ F
Sbjct: 13  DEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGF 72


>SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0)
          Length = 377

 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 28/58 (48%), Positives = 40/58 (68%)
 Frame = +2

Query: 344 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           VR+G + Q+F P+  + G+  A NN+A+GHYT G EL+D VLD +RK A+ C  L+ F
Sbjct: 3   VRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGF 60


>SB_35594| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 24/47 (51%), Positives = 34/47 (72%)
 Frame = +2

Query: 344 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRK 484
           VR+G + Q+F P+  + G+  A NN+A+GHYT G EL+D VLD +RK
Sbjct: 3   VRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRK 49


>SB_5512| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 365

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 25/58 (43%), Positives = 38/58 (65%)
 Frame = +2

Query: 344 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +R+G + Q+F P+  + G+  A NN+A+GHYT G E +D  LD +RK A+ C  L+ F
Sbjct: 3   IRTGTYRQLFHPEQLLSGKEDAANNYARGHYTVGKEHIDLALDRIRKLADQCTGLQGF 60


>SB_25311| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 629

 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 25/40 (62%), Positives = 31/40 (77%)
 Frame = +2

Query: 398 QSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Q+ A NNWAKG YTEGAEL+DS +D +RK AE CD ++ F
Sbjct: 2   QNSAANNWAKGFYTEGAELMDSGMDCIRKLAENCDTVQGF 41


>SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24)
          Length = 149

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 21/47 (44%), Positives = 30/47 (63%)
 Frame = +2

Query: 344 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRK 484
           VR G +  +F PD  + G+  A NN+A+GHYT G E +D  L+ +RK
Sbjct: 3   VRMGTYRDLFHPDQLITGKEDAANNYARGHYTVGKEHIDLTLEKIRK 49


>SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44)
          Length = 474

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 29/75 (38%), Positives = 38/75 (50%), Gaps = 3/75 (4%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRS--GPFGQIFRPDNFVFGQS-GAGNNWAKGHYTEGAELVDSVLD 472
           RAV +D+E   +    S     G    P    F Q  G+GNNWA G    G + +D VLD
Sbjct: 67  RAVSIDMESKVISQTLSEASKSGTWRYPKGQQFSQKRGSGNNWAHGFSEHGPKSIDKVLD 126

Query: 473 VVRKEAEGCDCLRVF 517
           +V++E E CD L  F
Sbjct: 127 LVQREVEKCDRLDGF 141



 Score = 31.9 bits (69), Expect = 0.40
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWEVISDE 200
           IV +Q GQCGNQIG + +++I ++
Sbjct: 3   IVTLQLGQCGNQIGRELFDLIVED 26


>SB_37976| Best HMM Match : Tubulin (HMM E-Value=4.5e-18)
          Length = 553

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 28/74 (37%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVR--SGPFGQIFRPDNFVFGQSGAGNNWAKGHYTE-----GAELVD 460
           R V VD E   + S R   G  GQ  R  N + G+ G GNN+A G++       G  L+ 
Sbjct: 40  RCVCVDSESKVIASNRRSDGVHGQN-RDSNIIAGRRGRGNNFALGYHGNSIDEGGTSLLH 98

Query: 461 SVLDVVRKEAEGCD 502
             +D +RKE E CD
Sbjct: 99  MTMDAMRKEVERCD 112


>SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 94

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 16/32 (50%), Positives = 23/32 (71%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVR 349
           S N +++E  GGK+VPRAV VDLEP  +  ++
Sbjct: 48  SFNTFFSETGGGKHVPRAVFVDLEPSVVGRMK 79



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 17/42 (40%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + +  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32)
          Length = 488

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 15/40 (37%), Positives = 24/40 (60%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNW 421
           RAV++D+E G ++++  GP   +F     +   SG GNNW
Sbjct: 76  RAVLIDMEEGVVNNILKGPLHDVFDCQQLITDVSGCGNNW 115


>SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL-QLEASMST 269
           MRE + I  GQ G QIG   WE+   EHGI   G    D    + + S ST
Sbjct: 196 MRECLSIHVGQAGVQIGNACWELYCLEHGIQPDGHMPSDQSADRCDDSFST 246


>SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 38

 Score = 30.7 bits (66), Expect = 0.93
 Identities = 11/15 (73%), Positives = 13/15 (86%)
 Frame = +3

Query: 177 FWEVISDEHGIDATG 221
           FWEVI++EHGID  G
Sbjct: 1   FWEVIAEEHGIDPDG 15


>SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083)
          Length = 1266

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 22/53 (41%), Positives = 24/53 (45%)
 Frame = -3

Query: 464  PNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
            P+Q VQ PL   L P Y PP  V            TA   R P  Q QGPP+Q
Sbjct: 1080 PHQAVQQPLPQQLPPQYRPPAIV------------TAAVARPP--QVQGPPTQ 1118


>SB_50693| Best HMM Match : C2 (HMM E-Value=0)
          Length = 1049

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
 Frame = -2

Query: 408 APDCPKTKLSGRKICPNGPERTESMVPGSRSTITAR----GTYLP 286
           A DCP ++ +GR +CP  P   +S +  ++++I       GT+ P
Sbjct: 138 AVDCPTSRKNGRGLCPFPPPPLQSALKRAKASIEVNDFTLGTHTP 182


>SB_47545| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 406

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 31/121 (25%), Positives = 46/121 (38%), Gaps = 17/121 (14%)
 Frame = -1

Query: 598 LDTLHGFWKSKESPYQIQ----------------YLLPENELAENPQTIAAFCFFSNYIQ 467
           L ++HG  KSK +PY  Q                  LP ++    P  +   CF  N   
Sbjct: 149 LCSVHGLKKSKTTPYHTQGNGLCERLNRTLHELLRTLPPDKKRRWPDHLRQLCFAYNATS 208

Query: 466 YRINQFSPLCVMXFRPVIPRPRLSEDEVVRSEDLPKRPGTDGV-HGSRLKVHHHSSRDVL 290
           +    +SP  VM  R     P+L  D ++  E+   +P T    H   L+  H  +   L
Sbjct: 209 HSTTGYSPFFVMYERD----PKLHIDRLIGEEETMDKPDTWVTRHTKELRKAHRRAAKRL 264

Query: 289 A 287
           A
Sbjct: 265 A 265


>SB_17458| Best HMM Match : Metalloenzyme (HMM E-Value=0.29)
          Length = 190

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +3

Query: 198 EHGIDATGAYSGDSDLQLEASMSTITK 278
           +HG+  TG + GDSD +L+A++   +K
Sbjct: 137 DHGMTRTGDHGGDSDDELDAALFVYSK 163


>SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1010

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = -2

Query: 399 CPKTKLSGRKICPNGPERTESMVPGSRSTITARGTYLPPEA 277
           CP+  +  RK  P+G +  +    G+ S + ++G  +PP A
Sbjct: 456 CPQGNMDYRKAAPDGRDMQQMGQKGNFSQMLSQGRGMPPGA 496


>SB_23752| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 620

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = -3

Query: 476 LHPVPNQPVQPPLCNXLSPSYSPP 405
           L PVP+ P Q P     +P+++PP
Sbjct: 476 LDPVPSAPTQAPTPTPAAPTHAPP 499


>SB_34911| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 904

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 1/51 (1%)
 Frame = -3

Query: 452 VQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRS-PWFQAQGPPSQL 303
           V PP+C+ L    S P      S      A+ A++G +  W + + P +QL
Sbjct: 193 VHPPICDCLGCRISSPVVASPESIREAFEAENAKDGNADDWGEVKTPTNQL 243


>SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015)
          Length = 592

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = -3

Query: 470 PVPNQPVQP-PLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQL 303
           PV + P  P P+ N + P   PP   +         A     G SP F +QGPP +L
Sbjct: 65  PVASTPPAPQPVPNNMGP---PPHVNQGPPPNSANQAPPPNPGPSPSFNSQGPPQRL 118


>SB_46977| Best HMM Match : Cu_amine_oxid (HMM E-Value=3.9e-09)
          Length = 549

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = -1

Query: 526 ELAENPQTIAAFCFFSNYIQYRINQFSPLCVMXFRPVIPRPRLSEDEVVRSEDL 365
           EL  + +   A+C    +++ R N   P  +  F+P  P  RLSE E+VR  DL
Sbjct: 386 ELNTDQRVYLAWCIL--FVETRGN---PKSLKAFQPFWPAIRLSELELVRRSDL 434


>SB_26176| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 535

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 13/43 (30%), Positives = 21/43 (48%)
 Frame = -3

Query: 461 NQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPW 333
           + P+QP LC  +SP  +     R+R+  +G  +  A   R  W
Sbjct: 479 SDPIQP-LCGPISPPQATTPQPRQRAHTIGAISDLAATRRHWW 520


>SB_46614| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 388

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 14/40 (35%), Positives = 21/40 (52%)
 Frame = +1

Query: 190 SRTSTALTPRVLTAATPTCSLKHQCLL*RSFRGQVRPASC 309
           ++ S  LT   L A  P    KH+C + +  +G +R ASC
Sbjct: 181 TKQSRKLTFIALCATHPRNVAKHRCDIDKGHQGSLRKASC 220


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,281,546
Number of Sequences: 59808
Number of extensions: 411609
Number of successful extensions: 1074
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 945
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1072
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1439498375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).