SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0013
         (698 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0)               56   3e-08
SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092)               34   0.096
SB_681| Best HMM Match : No HMM Matches (HMM E-Value=.)                29   3.6  
SB_51044| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.3  
SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.3  
SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09)              28   8.4  

>SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0)
          Length = 142

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 25/37 (67%), Positives = 29/37 (78%)
 Frame = +2

Query: 497 TGAGNPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           T   NP KSCKARGSNLRVH+KN +E AMAI+ M +R
Sbjct: 6   TDPENPTKSCKARGSNLRVHYKNTHEAAMAIKGMHVR 42



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 10/18 (55%), Positives = 15/18 (83%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRF 672
           RYLK+V  KK+ +PFR++
Sbjct: 46  RYLKDVCAKKQLVPFRKY 63


>SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092)
          Length = 783

 Score = 34.3 bits (75), Expect = 0.096
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = -1

Query: 470 ENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATTRSEAQRAL 321
           E EK+  + EL+    S  HF   E ++R   RA+ED+    +SE ++ L
Sbjct: 332 EEEKYGKDGELRMLKESLAHFQAEEAKKREQIRAMEDQRKQEQSEKEKEL 381


>SB_681| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +1

Query: 415 RRLAA*YCNSLFERCFSFSVLNIR*LKNGSRKPCEIMQSAWFKPP 549
           RRL+  +C     R F+ +VL ++  +N  +KP E  Q   F+PP
Sbjct: 20  RRLSDNWCRCPKARSFNSAVLRLKITRNNIKKPTEEQQ---FRPP 61


>SB_51044| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 610

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 22/104 (21%), Positives = 42/104 (40%), Gaps = 1/104 (0%)
 Frame = -2

Query: 451 RTASYNIKRPVAD-ISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDS 275
           ++ S ++ + V+  +SQ  +    QP +  +    RRG     R   +++  A L     
Sbjct: 382 QSVSQSVSQSVSQSVSQSVSQSVSQPGQNARDYWIRRGLSYLERYFFLILFNAYLHEQTF 441

Query: 274 VTSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARR 143
                HR   W++R+  H+     G+ S      +  TC  + R
Sbjct: 442 CRWMRHRP--WIYRMLSHIDIKEKGATSEFMMRTHQPTCLVSGR 483


>SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 14/36 (38%), Positives = 17/36 (47%)
 Frame = +3

Query: 504 PETLRNHAKRVVQTSVFTLRTHMRPQWQSERCRSVR 611
           P  LR++A   VQT     R+H  P    E  R VR
Sbjct: 63  PRCLRHYAMTAVQTKTILNRSHSLPALTFESARKVR 98


>SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1143

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 15/47 (31%), Positives = 25/47 (53%)
 Frame = -3

Query: 429 SGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRS 289
           S +SP+ P  RTT   S ++S       + R++ R    +SS +RR+
Sbjct: 155 SSKSPSPPTNRTTQGESPKTSSSGHGQHSSRTAVRRSASFSSSQRRT 201


>SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09)
          Length = 207

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = -2

Query: 364 KTAVPRRGAKLNARSTSILVRGASLGNGDSVTSNAHR 254
           KTAVPRRG K      S++ R   + + + +TS  HR
Sbjct: 112 KTAVPRRGVK-GLPLNSVIRRLVDVHSSEGMTSARHR 147


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,367,693
Number of Sequences: 59808
Number of extensions: 419000
Number of successful extensions: 1091
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1020
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1091
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1829596184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).