SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0011
         (548 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10)                   58   4e-09
SB_20687| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   4e-09
SB_57614| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   1e-08
SB_50221| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   1e-08
SB_39830| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   1e-08
SB_15102| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   1e-08
SB_3498| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   1e-08
SB_5733| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   4e-06

>SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10)
          Length = 229

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 35/88 (39%), Positives = 46/88 (52%), Gaps = 4/88 (4%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ES-IXNXRINLFSX 78
           QHFLGLAG PRRYSD  D Y   N++ S GS IS + V        ++ +   +   +  
Sbjct: 132 QHFLGLAGFPRRYSDFADGYAGWNLVCSFGSTISVVGVVWFIFVVYDAYVREVKFIGWVE 191

Query: 77  NLPS---SIE*YQNLPPAXXSYNERPIL 3
           N  S   S+E  Q  PPA  +YNE P +
Sbjct: 192 NTGSSWPSLEWVQQSPPALHTYNELPFV 219



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 32/90 (35%), Positives = 38/90 (42%)
 Frame = -2

Query: 514 IRFVFLFXVGGLTGVILANSXIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXLYV 335
           I FVFLF +GGLTGVILANS +                          + G Y      +
Sbjct: 46  IGFVFLFTIGGLTGVILANSSLDVVMHDTYYVVAHFHYVLSMGAVFAIFAGFYFWFG-KI 104

Query: 334 TGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
           TG        KI  + +FIGVN TF P  F
Sbjct: 105 TGYCYNELYGKIHFWIMFIGVNITFFPQHF 134



 Score = 36.7 bits (81), Expect = 0.012
 Identities = 15/20 (75%), Positives = 16/20 (80%)
 Frame = -3

Query: 450 LDITXHDTYXVVAXFHYVLS 391
           LD+  HDTY VVA FHYVLS
Sbjct: 67  LDVVMHDTYYVVAHFHYVLS 86


>SB_20687| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 35/88 (39%), Positives = 46/88 (52%), Gaps = 4/88 (4%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ES-IXNXRINLFSX 78
           QHFLGLAG PRRYSD  D Y   N++ S GS IS + V        ++ +   +   +  
Sbjct: 46  QHFLGLAGFPRRYSDFADGYAGWNLVCSFGSTISVVGVVWFIFVVYDAYVREVKFIGWVE 105

Query: 77  NLPS---SIE*YQNLPPAXXSYNERPIL 3
           N  S   S+E  Q  PPA  +YNE P +
Sbjct: 106 NTGSSWPSLEWVQQSPPALHTYNELPFV 133



 Score = 27.5 bits (58), Expect = 7.6
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = -2

Query: 337 VTGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
           +TG        KI  + +FIGVN TF P  F
Sbjct: 18  ITGYCYNELYGKIHFWIMFIGVNITFFPQHF 48


>SB_57614| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 34/87 (39%), Positives = 45/87 (51%), Gaps = 4/87 (4%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ES-IXNXRINLFSXN 75
           HFLGLAG PRRYSD  D Y   N++ S GS IS + V        ++ +   +   +  N
Sbjct: 1   HFLGLAGFPRRYSDFADGYAGWNLVCSFGSTISVVGVVWFIFVVYDAYVREVKFIGWVEN 60

Query: 74  LPS---SIE*YQNLPPAXXSYNERPIL 3
             S   S+E  Q  PPA  +YNE P +
Sbjct: 61  TGSSWPSLEWVQQSPPALHTYNELPFV 87


>SB_50221| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 34/87 (39%), Positives = 45/87 (51%), Gaps = 4/87 (4%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ES-IXNXRINLFSXN 75
           HFLGLAG PRRYSD  D Y   N++ S GS IS + V        ++ +   +   +  N
Sbjct: 1   HFLGLAGFPRRYSDFADGYAGWNLVCSFGSTISVVGVVWFIFVVYDAYVREVKFIGWVEN 60

Query: 74  LPS---SIE*YQNLPPAXXSYNERPIL 3
             S   S+E  Q  PPA  +YNE P +
Sbjct: 61  TGSSWPSLEWVQQSPPALHTYNELPFV 87


>SB_39830| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 34/87 (39%), Positives = 45/87 (51%), Gaps = 4/87 (4%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ES-IXNXRINLFSXN 75
           HFLGLAG PRRYSD  D Y   N++ S GS IS + V        ++ +   +   +  N
Sbjct: 1   HFLGLAGFPRRYSDFADGYAGWNLVCSFGSTISVVGVVWFIFVVYDAYVREVKFIGWVEN 60

Query: 74  LPS---SIE*YQNLPPAXXSYNERPIL 3
             S   S+E  Q  PPA  +YNE P +
Sbjct: 61  TGSSWPSLEWVQQSPPALHTYNELPFV 87


>SB_15102| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 34/87 (39%), Positives = 45/87 (51%), Gaps = 4/87 (4%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ES-IXNXRINLFSXN 75
           HFLGLAG PRRYSD  D Y   N++ S GS IS + V        ++ +   +   +  N
Sbjct: 1   HFLGLAGFPRRYSDFADGYAGWNLVCSFGSTISVVGVVWFIFVVYDAYVREVKFIGWVEN 60

Query: 74  LPS---SIE*YQNLPPAXXSYNERPIL 3
             S   S+E  Q  PPA  +YNE P +
Sbjct: 61  TGSSWPSLEWVQQSPPALHTYNELPFV 87


>SB_3498| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 34/87 (39%), Positives = 45/87 (51%), Gaps = 4/87 (4%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ES-IXNXRINLFSXN 75
           HFLGLAG PRRYSD  D Y   N++ S GS IS + V        ++ +   +   +  N
Sbjct: 1   HFLGLAGFPRRYSDFADGYAGWNLVCSFGSTISVVGVVWFIFVVYDAYVREVKFIGWVEN 60

Query: 74  LPS---SIE*YQNLPPAXXSYNERPIL 3
             S   S+E  Q  PPA  +YNE P +
Sbjct: 61  TGSSWPSLEWVQQSPPALHTYNELPFV 87


>SB_5733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 22/37 (59%), Positives = 25/37 (67%)
 Frame = -1

Query: 251 HFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSV 141
           HFLGLAG PRRYSD  D Y   N++ S GS IS + V
Sbjct: 1   HFLGLAGFPRRYSDFADGYAGWNLVCSFGSTISVVGV 37


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,152,556
Number of Sequences: 59808
Number of extensions: 109740
Number of successful extensions: 118
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 102
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 111
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1264269032
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).