SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0010
         (598 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_44686| Best HMM Match : DUF1126 (HMM E-Value=0.37)                  49   2e-06
SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     29   3.8  
SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.8  
SB_51241| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_18526| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     29   3.8  
SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     28   6.6  
SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32)             28   6.6  
SB_29057| Best HMM Match : Rad9 (HMM E-Value=9.3e-10)                  27   8.7  
SB_22852| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.7  

>SB_44686| Best HMM Match : DUF1126 (HMM E-Value=0.37)
          Length = 93

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 28/81 (34%), Positives = 41/81 (50%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           ++++F  E YD  A   +   L ++  DNSV++ D K  +  LKR +      D   IG 
Sbjct: 5   ERFAFLAEWYDPQAALTRKYQLLFYASDNSVEMYDIKNRRLFLKRSKCDQYKADDFYIGA 64

Query: 435 IVNIFSKLLYIQDCGSCYTEN 497
           IVNI S+ L I D    +T N
Sbjct: 65  IVNIHSRQLKITDYCDKHTTN 85


>SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 777

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +3

Query: 468 QDCGSCYTENAFQKCQVLCHDXSR*LPVDL 557
           ++CG C+T+NA  K  ++ H   +  P+ L
Sbjct: 750 EECGKCFTQNAHLKTHLMIHSGQK--PIQL 777


>SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 391

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 8/35 (22%), Positives = 17/35 (48%)
 Frame = +3

Query: 423 QIGNIVNIFSKLLYIQDCGSCYTENAFQKCQVLCH 527
           ++   +N+  K     +CG C+T  A+ +   + H
Sbjct: 16  EVSKALNLSEKAYKCDECGKCFTRRAYLRAHAIIH 50


>SB_51241| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 205

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = -3

Query: 386 FQNIFAFLRVYYLNRIVKWKIIEG*IFYFVSILIIHFTXETIFIK*SYTIAI 231
           + N    L V+Y NR++   ++     YFV +L +H+T   I +   YT  +
Sbjct: 57  YTNRVIVLPVHYTNRVI---VLPVNYTYFVIVLPVHYTNRVIVLPVHYTYLV 105


>SB_18526| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 322

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +3

Query: 468 QDCGSCYTENAFQKCQVLCHDXSR*LPVDL 557
           ++CG C+T+NA  K  ++ H   +  P+ L
Sbjct: 295 EECGKCFTQNAHLKTHLMIHSGQK--PIQL 322


>SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 426

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 8/35 (22%), Positives = 17/35 (48%)
 Frame = +3

Query: 423 QIGNIVNIFSKLLYIQDCGSCYTENAFQKCQVLCH 527
           ++   +N+  K     +CG C+T  A+ +   + H
Sbjct: 51  EVSKALNLSEKAYKCDECGKCFTRPAYLRAHAIIH 85


>SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32)
          Length = 488

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 11/41 (26%), Positives = 22/41 (53%)
 Frame = +3

Query: 300 EIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDML 422
           ++ ++T+N  PF     ++ ++     L  V+LPP  LD +
Sbjct: 298 DLNEITMNLVPFPKLHYLVSSQTPLYALTDVKLPPRRLDQM 338


>SB_29057| Best HMM Match : Rad9 (HMM E-Value=9.3e-10)
          Length = 336

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +3

Query: 231 DSNGIRLLDKYSFXCEMYDEDADEIKDLT 317
           D + +R L + S   E+YDED D++   T
Sbjct: 299 DRSQVRKLSRESLDLELYDEDQDDVLPAT 327


>SB_22852| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 49

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +3

Query: 231 DSNGIRLLDKYSFXCEMYDEDADEIKDLT 317
           D + +R L + S   E+YDED D++   T
Sbjct: 16  DRSQVRKLSRESLDLELYDEDQDDVLPAT 44


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,556,906
Number of Sequences: 59808
Number of extensions: 301619
Number of successful extensions: 780
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 638
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 778
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1439498375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).