SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0008
         (698 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_9743| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.22 
SB_57739| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.6  
SB_10512| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_57782| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.8  
SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1)                    29   4.8  
SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.3  
SB_7455| Best HMM Match : HC2 (HMM E-Value=8.7)                        28   6.3  
SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_16907| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  

>SB_9743| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 33.1 bits (72), Expect = 0.22
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = +2

Query: 470 NERHPADTGRWRAQGQASPGIFNSRGAADGSDISSRRFID 589
           N +  AD G +  +G+A  G+FN +G AD    +++R  D
Sbjct: 70  NNKGVADKGLFNNKGEADKGLFNDKGEADKGLFNNKRVAD 109


>SB_57739| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 393

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 6/89 (6%)
 Frame = +3

Query: 303 YIEDENVEFPTCCARLRCVVEVNGERI----VQTRGQPGELFPDKPWKGQQNEPNPAVV- 467
           Y+ D       C  R+RC+   N  R     V TR + G       +  +  +  PA+V 
Sbjct: 280 YVGDIKQNRMKCLVRVRCIHSANQHRASHVTVFTRQRVGNGLLQAVYNHEYEKCVPAIVL 339

Query: 468 -GMSGIQQTPVGGEPRVRRLLEYLTAEEQ 551
             +  ++Q  V  +PR RRLL+    +EQ
Sbjct: 340 APVFAVEQGKVPVKPRGRRLLKKKDMDEQ 368


>SB_10512| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 10/35 (28%), Positives = 16/35 (45%)
 Frame = +3

Query: 252 CGCRKPKIPENALECHEYIEDENVEFPTCCARLRC 356
           C  +KP +P++    HE +    +    C  R RC
Sbjct: 28  CLAQKPGVPQDTRHSHEPLPQRKISLIVCSTRTRC 62


>SB_57782| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 310

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -1

Query: 119 SADRAGKTRQHNINNAPNCFPCCIL 45
           SA+   K R H+  N  +CF CCIL
Sbjct: 279 SANDKKKKRLHDSANQKSCFTCCIL 303


>SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1)
          Length = 1188

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = +3

Query: 270 KIPENALECHEYIEDENVEFPT 335
           ++ E+ LEC EYI ++N EF T
Sbjct: 513 EMSESILECFEYIPEKNTEFMT 534


>SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1981

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 14/39 (35%), Positives = 16/39 (41%)
 Frame = +3

Query: 225 QRREILHSCCGCRKPKIPENALECHEYIEDENVEFPTCC 341
           QRRE   +  G    K  E     H+   D NV F  CC
Sbjct: 731 QRREGFKTAEGSEARKQDERRFRLHQSSSDSNVYFSQCC 769


>SB_7455| Best HMM Match : HC2 (HMM E-Value=8.7)
          Length = 153

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 440 TKRAKSCCCRNERHPADTGRWRAQGQASPGIFNSRGAADGSDISSRRFID 589
           TKR       N +  AD G +  +  A  G+FN++  AD    +++R  D
Sbjct: 6   TKRGADKGLFNNKRVADKGLFNNKRVADKGLFNNKRVADKGLFNNKRVAD 55


>SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1593

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = +1

Query: 214 RCEIRDGKYFIAAVDVENQKYRKTHWNATNTSK 312
           +C I  G+Y+I     + Q++R   WNA +T++
Sbjct: 497 QCNIIHGRYYIFHHKKDVQRHRYLVWNANDTTR 529


>SB_16907| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 886

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%)
 Frame = +3

Query: 399 QPGELF-PDKPWKGQQNEPNP 458
           QP ELF P+ P K QQN+P P
Sbjct: 121 QPVELFAPNSPPKPQQNQPKP 141


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,166,528
Number of Sequences: 59808
Number of extensions: 545019
Number of successful extensions: 1594
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1415
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1593
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1829596184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).