SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0006
         (698 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_28941| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.8026e-45)     29   2.7  
SB_48429| Best HMM Match : PI3_PI4_kinase (HMM E-Value=7.7e-09)        29   2.7  
SB_51745| Best HMM Match : DPRP (HMM E-Value=0.33)                     29   4.8  
SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.8  
SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13)         29   4.8  
SB_51743| Best HMM Match : DPRP (HMM E-Value=0.4)                      29   4.8  
SB_10901| Best HMM Match : SAM_1 (HMM E-Value=2.5e-09)                 28   6.3  
SB_947| Best HMM Match : Phage_term_smal (HMM E-Value=2.8)             28   6.3  
SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_1692| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.4  

>SB_28941| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.8026e-45)
          Length = 2022

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +1

Query: 292  SGREHRTSHPLEAAADRRNPQVRRQGPHD 378
            SG+   TSHPL +   + + Q++RQ  HD
Sbjct: 1862 SGQVCNTSHPLHSLQAKFDEQIKRQADHD 1890


>SB_48429| Best HMM Match : PI3_PI4_kinase (HMM E-Value=7.7e-09)
          Length = 1423

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +1

Query: 292 SGREHRTSHPLEAAADRRNPQVRRQGPHD 378
           SG+   TSHPL +   + + Q++RQ  HD
Sbjct: 250 SGQVCNTSHPLHSLQAKFDEQIKRQADHD 278


>SB_51745| Best HMM Match : DPRP (HMM E-Value=0.33)
          Length = 352

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVHTMSLP-RASAPPGLRPNEIIDQFHVTNFNVRL 466
           PQL+DG+L+ G R+    +P     P  L   + + +  VT ++ +L
Sbjct: 220 PQLVDGVLRVGGRIDRADIPWETKHPIILDHGQDVTRLIVTEYHQKL 266


>SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 989

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVHTMSLP-RASAPPGLRPNEIIDQFHVTNFNVRL 466
           PQL+DG+L+ G R+    +P     P  L   + + +  VT ++ +L
Sbjct: 727 PQLVDGVLRVGGRIDRADIPWETKHPIILDHGQDVTRLIVTEYHQKL 773


>SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13)
          Length = 1012

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +2

Query: 329  PQLIDGILKYGDRVHTMSLP-RASAPPGLRPNEIIDQFHVTNFNVRL 466
            PQL+DG+L+ G R+    +P     P  L   + + +  VT ++ +L
Sbjct: 945  PQLVDGVLRVGGRIDRADIPWETKHPIILDHGQDVTRLIVTEYHQKL 991


>SB_51743| Best HMM Match : DPRP (HMM E-Value=0.4)
          Length = 281

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVHTMSLP-RASAPPGLRPNEIIDQFHVTNFNVRL 466
           PQL+DG+L+ G R+    +P     P  L   + + +  VT ++ +L
Sbjct: 233 PQLVDGVLRVGGRIDRADIPWETKHPIILDHGQDVTRLIVTEYHQKL 279


>SB_10901| Best HMM Match : SAM_1 (HMM E-Value=2.5e-09)
          Length = 1472

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 15/43 (34%), Positives = 18/43 (41%)
 Frame = +1

Query: 313 SHPLEAAADRRNPQVRRQGPHDVSAQSFCSARTTPQRDYRPVP 441
           SHPL       NP+   + P      S  +  TT QRD  P P
Sbjct: 802 SHPLAPFTSESNPRPETKVPITTIGASTSAEVTTSQRDLMPSP 844


>SB_947| Best HMM Match : Phage_term_smal (HMM E-Value=2.8)
          Length = 237

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVHTMSLP 388
           PQL+DG+L+ G R+    LP
Sbjct: 124 PQLVDGVLRVGGRIDKADLP 143


>SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1497

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329  PQLIDGILKYGDRVHTMSLPRASAPP 406
            PQL+DG+L+ G R+    +P  +  P
Sbjct: 1144 PQLVDGVLRVGGRIDRADIPWETKHP 1169


>SB_1692| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 190

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVHTMSLPRASAPP 406
           PQL+DG+L+ G R+    +P  +  P
Sbjct: 150 PQLVDGVLRVGGRIDRADIPWETKHP 175


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,181,818
Number of Sequences: 59808
Number of extensions: 349669
Number of successful extensions: 953
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 884
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 952
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1829596184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).