SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0005
         (698 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_45794| Best HMM Match : zf-CCCH (HMM E-Value=3.1e-27)              104   6e-23
SB_34807| Best HMM Match : zf-CCCH (HMM E-Value=4.6e-07)               35   0.073
SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09)                 34   0.13 
SB_14893| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.6  
SB_38162| Best HMM Match : zf-CCCH (HMM E-Value=0.018)                 29   3.6  
SB_282| Best HMM Match : zf-CCCH (HMM E-Value=2.4e-10)                 29   4.8  
SB_6600| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.8  
SB_34146| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_20270| Best HMM Match : Flavodoxin_1 (HMM E-Value=3.1e-35)          28   8.4  
SB_4107| Best HMM Match : M (HMM E-Value=8e-22)                        28   8.4  
SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_24759| Best HMM Match : Neur_chan_LBD (HMM E-Value=0.59)            28   8.4  

>SB_45794| Best HMM Match : zf-CCCH (HMM E-Value=3.1e-27)
          Length = 527

 Score =  104 bits (250), Expect = 6e-23
 Identities = 40/49 (81%), Positives = 44/49 (89%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG  ELR L RHPKYKTELCRTFH++GFCPYGPRCHF+HNA+E R
Sbjct: 175 CQFAHGYHELRQLARHPKYKTELCRTFHTIGFCPYGPRCHFIHNADEKR 223



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 19/40 (47%), Positives = 22/40 (55%)
 Frame = +1

Query: 286 RNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           R  Q   +YKTELCR F   G C YG +C F H   E R+
Sbjct: 147 RGSQNSSRYKTELCRPFEESGTCKYGDKCQFAHGYHELRQ 186



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 17/19 (89%), Positives = 18/19 (94%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE+G CKYGD
Sbjct: 155 YKTELCRPFEESGTCKYGD 173



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 193 YKTELCRTFHTIGFCPYGPRCHFI 216


>SB_34807| Best HMM Match : zf-CCCH (HMM E-Value=4.6e-07)
          Length = 505

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVH 384
           K  LCR F + G+C YG +C FVH
Sbjct: 14  KPTLCRYFSANGYCFYGDQCQFVH 37


>SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09)
          Length = 321

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 179 YQPDICKDYKETGFCGFGDSCKFLHDRSD 207



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 179 YQPDICKDYKETGFCGFGDSCKFLHDRSDY 208


>SB_14893| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 735

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 13/43 (30%), Positives = 19/43 (44%)
 Frame = +3

Query: 510 PLTPHSPPAMSPPAQATAFAFRRTNSPDPEDDRLPVFNRLFIG 638
           P+ P+  P   PP+       RR  SPDP  +R+       +G
Sbjct: 193 PVVPNMRPTNQPPSHPNHVTSRRALSPDPRTNRVSAIVFFVVG 235


>SB_38162| Best HMM Match : zf-CCCH (HMM E-Value=0.018)
          Length = 541

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 14/28 (50%), Positives = 16/28 (57%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           HP +    CRTF +   CPYG  C FVH
Sbjct: 444 HPTFP---CRTFPN---CPYGKSCMFVH 465


>SB_282| Best HMM Match : zf-CCCH (HMM E-Value=2.4e-10)
          Length = 508

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = +1

Query: 313 KTELCRTFHSVGFCPYGPRCHFVH 384
           + ++CR +   G C +G +C FVH
Sbjct: 39  RQKVCRFYAKKGNCRFGEKCRFVH 62


>SB_6600| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 245

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 16/40 (40%), Positives = 20/40 (50%)
 Frame = -3

Query: 534 QVESEASMEMRRAWRSRPVAHIRRHRSAR*ERCQ*TSWRR 415
           +VE+E  +E RR WR R     RR    R +  Q   WRR
Sbjct: 91  EVETEKEVEKRRKWRHRRKWRQRRKWRQRRKWRQRKKWRR 130



 Score = 28.7 bits (61), Expect = 4.8
 Identities = 16/40 (40%), Positives = 20/40 (50%)
 Frame = -3

Query: 534 QVESEASMEMRRAWRSRPVAHIRRHRSAR*ERCQ*TSWRR 415
           +VE+E  +E RR WR R     RR    R +  Q   WRR
Sbjct: 173 EVETEKEVEERRKWRQRRKWRQRRKWRQRRKWRQRRKWRR 212


>SB_34146| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 15/43 (34%), Positives = 20/43 (46%)
 Frame = +3

Query: 486 AIATLAAFPLTPHSPPAMSPPAQATAFAFRRTNSPDPEDDRLP 614
           AI +   F + P SPP  SPP + +    R+    DP   R P
Sbjct: 47  AILSQPHFAMPPASPPKKSPPPEKSPAEKRKEKLEDPGMFRPP 89


>SB_20270| Best HMM Match : Flavodoxin_1 (HMM E-Value=3.1e-35)
          Length = 724

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 2/32 (6%)
 Frame = +3

Query: 156 PPVNRLLRHQPQVATRP--SSADRLKKRGFVN 245
           PP  RLL H P+++ RP   S+  L+K G +N
Sbjct: 454 PPFERLLEHLPRLSPRPYSISSSPLEKPGQLN 485


>SB_4107| Best HMM Match : M (HMM E-Value=8e-22)
          Length = 2039

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 18/80 (22%), Positives = 40/80 (50%), Gaps = 4/80 (5%)
 Frame = +2

Query: 290  IFSVILNTRRSCVALSIRLASVLMDRVAISCITQRKQD----AENHRRQEVHWHRSHRAD 457
            +F+ + N +        R  ++L++ +AI  I + + D    AEN ++Q +H   + +A 
Sbjct: 933  VFNALTNEKNELAKRLDREKALLVNEIAI--IQKERDDQLLMAENEKQQALHVAANEKAT 990

Query: 458  LWRRI*ATGRDRHARRISID 517
            L  ++   G+D+    + +D
Sbjct: 991  LVEKMTKLGQDKENVGVELD 1010


>SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 499

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHN 387
           K K  +C  F   G C +G +C FVHN
Sbjct: 105 KGKKRVCWKFQK-GKCRFGEKCKFVHN 130


>SB_24759| Best HMM Match : Neur_chan_LBD (HMM E-Value=0.59)
          Length = 262

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +2

Query: 239 CKYGDNANLLTASANYAIFSVILNTRRSCVALSIRL-ASVLMDRVAISCITQRKQDAENH 415
           C YG +   +T        +V++ T ++CV++S+ L AS+L+ +   SC    +    N+
Sbjct: 194 CSYGHDTVTVTIQERSGSGTVMIVTIQTCVSISLTLNASLLLSQ---SCFVNGRHFCYNN 250

Query: 416 RRQ 424
           + Q
Sbjct: 251 QTQ 253


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,210,723
Number of Sequences: 59808
Number of extensions: 436302
Number of successful extensions: 1577
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1448
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1568
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1829596184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).