SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0004
         (598 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_947| Best HMM Match : Phage_term_smal (HMM E-Value=2.8)             28   6.6  
SB_51745| Best HMM Match : DPRP (HMM E-Value=0.33)                     27   8.7  
SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.7  
SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13)         27   8.7  
SB_28941| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.8026e-45)     27   8.7  
SB_51743| Best HMM Match : DPRP (HMM E-Value=0.4)                      27   8.7  
SB_48429| Best HMM Match : PI3_PI4_kinase (HMM E-Value=7.7e-09)        27   8.7  
SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.7  
SB_1692| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   8.7  

>SB_947| Best HMM Match : Phage_term_smal (HMM E-Value=2.8)
          Length = 237

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMXLP 388
           PQL+DG+L+ G R+    LP
Sbjct: 124 PQLVDGVLRVGGRIDKADLP 143


>SB_51745| Best HMM Match : DPRP (HMM E-Value=0.33)
          Length = 352

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMXLPRASAPP 406
           PQL+DG+L+ G R+    +P  +  P
Sbjct: 220 PQLVDGVLRVGGRIDRADIPWETKHP 245


>SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 989

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMXLPRASAPP 406
           PQL+DG+L+ G R+    +P  +  P
Sbjct: 727 PQLVDGVLRVGGRIDRADIPWETKHP 752


>SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13)
          Length = 1012

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329  PQLIDGILKYGDRVXTMXLPRASAPP 406
            PQL+DG+L+ G R+    +P  +  P
Sbjct: 945  PQLVDGVLRVGGRIDRADIPWETKHP 970


>SB_28941| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.8026e-45)
          Length = 2022

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +1

Query: 295  GREHRTSHPLEXAADRRNPQVRRQGXHDXSAQS 393
            G+   TSHPL     + + Q++RQ  HD   +S
Sbjct: 1863 GQVCNTSHPLHSLQAKFDEQIKRQADHDKVLRS 1895


>SB_51743| Best HMM Match : DPRP (HMM E-Value=0.4)
          Length = 281

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMXLPRASAPP 406
           PQL+DG+L+ G R+    +P  +  P
Sbjct: 233 PQLVDGVLRVGGRIDRADIPWETKHP 258


>SB_48429| Best HMM Match : PI3_PI4_kinase (HMM E-Value=7.7e-09)
          Length = 1423

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +1

Query: 295 GREHRTSHPLEXAADRRNPQVRRQGXHDXSAQS 393
           G+   TSHPL     + + Q++RQ  HD   +S
Sbjct: 251 GQVCNTSHPLHSLQAKFDEQIKRQADHDKVLRS 283


>SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1497

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329  PQLIDGILKYGDRVXTMXLPRASAPP 406
            PQL+DG+L+ G R+    +P  +  P
Sbjct: 1144 PQLVDGVLRVGGRIDRADIPWETKHP 1169


>SB_1692| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 190

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 329 PQLIDGILKYGDRVXTMXLPRASAPP 406
           PQL+DG+L+ G R+    +P  +  P
Sbjct: 150 PQLVDGVLRVGGRIDRADIPWETKHP 175


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,155,684
Number of Sequences: 59808
Number of extensions: 174969
Number of successful extensions: 482
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 449
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 481
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1439498375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).