SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0002
         (598 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.)             109   2e-24
SB_27337| Best HMM Match : efhand (HMM E-Value=2.9e-21)                82   4e-16
SB_37032| Best HMM Match : efhand (HMM E-Value=4.7e-35)                47   1e-05
SB_27027| Best HMM Match : efhand (HMM E-Value=8.7e-08)                45   5e-05
SB_3425| Best HMM Match : No HMM Matches (HMM E-Value=.)               43   2e-04
SB_2973| Best HMM Match : efhand (HMM E-Value=2e-09)                   43   2e-04
SB_693| Best HMM Match : efhand (HMM E-Value=2e-09)                    43   2e-04
SB_34345| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   7e-04
SB_26916| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   9e-04
SB_18908| Best HMM Match : efhand (HMM E-Value=5.5e-31)                40   0.002
SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11)                    40   0.002
SB_26865| Best HMM Match : efhand (HMM E-Value=7.5e-08)                40   0.002
SB_5690| Best HMM Match : efhand (HMM E-Value=7.39998e-41)             39   0.003
SB_57699| Best HMM Match : efhand (HMM E-Value=1e-08)                  38   0.008
SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.008
SB_18942| Best HMM Match : efhand (HMM E-Value=1.7e-30)                37   0.014
SB_59144| Best HMM Match : efhand (HMM E-Value=0.093)                  34   0.076
SB_37225| Best HMM Match : LRR_1 (HMM E-Value=2.6e-11)                 34   0.10 
SB_35284| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.10 
SB_13634| Best HMM Match : efhand (HMM E-Value=2e-24)                  34   0.10 
SB_6736| Best HMM Match : efhand (HMM E-Value=2.6e-21)                 33   0.13 
SB_36414| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.13 
SB_23229| Best HMM Match : efhand (HMM E-Value=6.8e-25)                33   0.18 
SB_23228| Best HMM Match : efhand (HMM E-Value=6.8e-25)                33   0.18 
SB_34261| Best HMM Match : efhand (HMM E-Value=5.3e-14)                33   0.23 
SB_49196| Best HMM Match : efhand (HMM E-Value=3.4e-39)                33   0.23 
SB_44952| Best HMM Match : efhand (HMM E-Value=3.4e-39)                33   0.23 
SB_7126| Best HMM Match : efhand (HMM E-Value=2e-26)                   33   0.23 
SB_844| Best HMM Match : No HMM Matches (HMM E-Value=.)                32   0.31 
SB_28695| Best HMM Match : Ras (HMM E-Value=0)                         32   0.31 
SB_23227| Best HMM Match : efhand (HMM E-Value=4.8e-26)                31   0.53 
SB_53403| Best HMM Match : efhand (HMM E-Value=2.8e-12)                31   0.53 
SB_43892| Best HMM Match : efhand (HMM E-Value=2.3e-11)                31   0.53 
SB_31141| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.53 
SB_11877| Best HMM Match : efhand (HMM E-Value=7.8e-07)                31   0.53 
SB_42267| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=5.9e-12)          31   0.71 
SB_8146| Best HMM Match : efhand (HMM E-Value=1.2e-16)                 31   0.71 
SB_13209| Best HMM Match : LRR_1 (HMM E-Value=1.7e-13)                 31   0.93 
SB_38608| Best HMM Match : Peptidase_C2 (HMM E-Value=0)                31   0.93 
SB_31565| Best HMM Match : efhand (HMM E-Value=3.4e-06)                30   1.6  
SB_16925| Best HMM Match : efhand (HMM E-Value=3e-22)                  30   1.6  
SB_46583| Best HMM Match : Hus1 (HMM E-Value=0)                        29   2.2  
SB_11457| Best HMM Match : efhand (HMM E-Value=0.0066)                 29   2.9  
SB_8159| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   2.9  
SB_49265| Best HMM Match : efhand (HMM E-Value=0.68)                   29   2.9  
SB_50111| Best HMM Match : GCC2_GCC3 (HMM E-Value=0)                   29   3.8  
SB_22463| Best HMM Match : VWA (HMM E-Value=0)                         28   5.0  
SB_20284| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.0  
SB_59345| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_53082| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_43954| Best HMM Match : efhand (HMM E-Value=4.3e-23)                28   6.6  
SB_47001| Best HMM Match : Asparaginase_2 (HMM E-Value=2.5e-40)        27   8.7  
SB_21457| Best HMM Match : efhand (HMM E-Value=1.7e-29)                27   8.7  
SB_12096| Best HMM Match : ig (HMM E-Value=9.4e-33)                    27   8.7  

>SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 457

 Score =  109 bits (262), Expect = 2e-24
 Identities = 53/113 (46%), Positives = 74/113 (65%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           RL CLSRG+SGI GLGR F+ MDDDG++ L+  EF  G+++ G+ L   E +  F  FDT
Sbjct: 30  RLACLSRGSSGIKGLGRTFKIMDDDGNRSLDFNEFKKGLRDYGVMLEPKEVKRTFEAFDT 89

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYSV 593
           D SG+I  DEFLI++RPPMS++R+ +  +    L +       +  LKGVY+V
Sbjct: 90  DGSGTIDFDEFLIRLRPPMSKARKNVIQQAFNKLDKTGDNNITVEDLKGVYNV 142


>SB_27337| Best HMM Match : efhand (HMM E-Value=2.9e-21)
          Length = 172

 Score = 81.8 bits (193), Expect = 4e-16
 Identities = 42/106 (39%), Positives = 62/106 (58%)
 Frame = +3

Query: 273 RGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSI 452
           RG  GI   GR FR  DDDG++ LN +EF  G+++ G +L   E ++LF+QFD D SGS+
Sbjct: 32  RGTCGIKMFGRAFRIFDDDGNRALNIDEFRKGMQDFGTKLTDDEVKQLFAQFDKDGSGSL 91

Query: 453 SLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYS 590
             +EFL  +RP MS++R ++  K    +         +  LK VY+
Sbjct: 92  DFEEFLRAVRPSMSKNRVEIIMKAFHKMDTTGDGVITIADLKKVYN 137


>SB_37032| Best HMM Match : efhand (HMM E-Value=4.7e-35)
          Length = 552

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 23/56 (41%), Positives = 34/56 (60%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           R FR +D DGS L N  +F   +K   ++LN+ E   ++S +D D +G IS +EFL
Sbjct: 492 RAFRAIDKDGSGLCNPLDFRQMLKRFKIDLNEEEFFHVYSFYDKDMTGKISYNEFL 547



 Score = 29.9 bits (64), Expect = 1.6
 Identities = 17/67 (25%), Positives = 31/67 (46%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D  GS L++KE+    I      +   + + L +Q   D +G +S ++FL      
Sbjct: 179 FSAFDSSGSGLVSKEDLHQIINAFCFIMTDKQFQVLLNQLCVDRNGLLSYEDFLQSFNKS 238

Query: 489 MSESRRK 509
            +E+ +K
Sbjct: 239 DNEASQK 245


>SB_27027| Best HMM Match : efhand (HMM E-Value=8.7e-08)
          Length = 103

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 21/59 (35%), Positives = 34/59 (57%)
 Frame = +3

Query: 315 RMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPPM 491
           + D DGS  ++ EE  Y +  +G +L++ EA EL   FD +  G +S +EF+  I+  M
Sbjct: 2   KFDRDGSGYISPEELRYVVCHSGEKLSEDEARELIDMFDKNKDGQLSWEEFVEFIKTSM 60


>SB_3425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 304

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = +3

Query: 273 RGASGIL-GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGS 449
           RGA  +   L + FR  D +G   ++ EE    +   G  L + EAEEL    D D  G 
Sbjct: 210 RGAEKLEENLRQAFRVFDRNGDGYISAEELRVAVTTLGDALTQDEAEELIGMLDQDGDGK 269

Query: 450 ISLDEFLIKIRPPMSESRRKL*NKHSRS 533
           +  +EF++  +  + E  + L ++   S
Sbjct: 270 LGYEEFVVIAKKSLKECIKALEHRGGES 297


>SB_2973| Best HMM Match : efhand (HMM E-Value=2e-09)
          Length = 508

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FRR+D D S  ++  EF+ G++++ + L   E E++    D D  G I   EF+
Sbjct: 431 LFRRLDKDQSMQVSVREFVEGLRKSDVGLTAFEVEKIIESLDVDDDGEIDYSEFV 485


>SB_693| Best HMM Match : efhand (HMM E-Value=2e-09)
          Length = 500

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FRR+D D S  ++  EF+ G++++ + L   E E++    D D  G I   EF+
Sbjct: 423 LFRRLDKDQSMQVSVREFVEGLRKSDVGLTAFEVEKIIESLDVDDDGEIDYSEFV 477


>SB_34345| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 481

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 2/76 (2%)
 Frame = +3

Query: 291 LGLGRIFRRMDDD--GSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           L L  +F+ + ++  GS ++ KE+F+ G+++  L + + +   LF   D D SG ++  E
Sbjct: 386 LRLHDLFKMLSNNYSGSVVMKKEDFVAGMRKLKLPMGEQQLAALFDTIDDDGSGGLTYQE 445

Query: 465 FLIKIRPPMSESRRKL 512
           F+   +   S +R+ L
Sbjct: 446 FINMKKRRQSRTRKGL 461


>SB_26916| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1732

 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 18/48 (37%), Positives = 28/48 (58%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSI 452
           F + D D S  +++EEF  G+KETGL + K + + L    D ++ G I
Sbjct: 561 FNQFDKDHSGGISREEFSKGLKETGLVMTKRQLDRLMEYIDINNDGEI 608



 Score = 27.9 bits (59), Expect = 6.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +3

Query: 393 NKSEAEELFSQFDTDSSGSISLDEF 467
           N+    + F+QFD D SG IS +EF
Sbjct: 553 NRLRLIDWFNQFDKDHSGGISREEF 577


>SB_18908| Best HMM Match : efhand (HMM E-Value=5.5e-31)
          Length = 156

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 22/54 (40%), Positives = 29/54 (53%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +F + D DGS  L K E +  +K   L L+  +AE      D D SGS+S DEF
Sbjct: 19  LFTKYDKDGSGRLQKTEMMELLK-VDLGLDDKQAETFLLLVDKDGSGSVSFDEF 71



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +F++ D D S  +++EEF   + ETG   NK   ++   + D D +G IS  EFL
Sbjct: 99  MFKKYDKDASGSIDREEFKQLMHETG---NKVNIDKALKKLDKDGNGQISFTEFL 150



 Score = 29.1 bits (62), Expect = 2.9
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 9/59 (15%)
 Frame = +3

Query: 318 MDDDGSKLLNKEEFLYGIKETGLELN---KS------EAEELFSQFDTDSSGSISLDEF 467
           +D DGS  ++ +EF   I +     N   KS      +A E+F ++D D+SGSI  +EF
Sbjct: 58  VDKDGSGSVSFDEFYTWIHDKNTLQNIDDKSRYHKIRKAIEMFKKYDKDASGSIDREEF 116


>SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11)
          Length = 1771

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 3/84 (3%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF--LIKI 479
            +FR +D      LN  +F +    +  +L+KSE   +F   D D SGSI  DEF  L  I
Sbjct: 1393 LFRLLDVHDEMALNDIQF-WSFMRSATDLSKSEIYTVFDMLDVDCSGSIDFDEFYLLFCI 1451

Query: 480  RPPMSESRRK-L*NKHSRSLTRLV 548
               + +   K   ++HSR++  L+
Sbjct: 1452 LIAVKDKEEKHFIHRHSRTVFDLL 1475


>SB_26865| Best HMM Match : efhand (HMM E-Value=7.5e-08)
          Length = 151

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 3/84 (3%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF--LIKI 479
           +FR +D      LN  +F +    +  +L+KSE   +F   D D SGSI  DEF  L  I
Sbjct: 10  LFRLLDVHDEMALNDIQF-WSFMRSATDLSKSEIYTVFDMLDVDCSGSIDFDEFYLLFCI 68

Query: 480 RPPMSESRRK-L*NKHSRSLTRLV 548
              + +   K   ++HSR++  L+
Sbjct: 69  LIAVKDKEEKHFIHRHSRTVFDLL 92


>SB_5690| Best HMM Match : efhand (HMM E-Value=7.39998e-41)
          Length = 153

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/61 (27%), Positives = 30/61 (49%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DGS  ++ EE    +K  G   +  E +++  + D D +G +  +EFL  ++  
Sbjct: 6   FSLFDKDGSGTISNEELEVVMKSLGQNPSDEELQQMIQEVDADGNGEVDFEEFLAMMKKQ 65

Query: 489 M 491
           M
Sbjct: 66  M 66


>SB_57699| Best HMM Match : efhand (HMM E-Value=1e-08)
          Length = 676

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/54 (29%), Positives = 26/54 (48%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +F + D D S  + ++EF  G+K  G+ ++  +   L    D D  G I   EF
Sbjct: 610 LFNQFDKDNSLSVTRDEFYTGLKGIGVPMSDKDLTMLIDLLDEDGDGEIDFSEF 663



 Score = 28.7 bits (61), Expect = 3.8
 Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 3/32 (9%)
 Frame = +3

Query: 411 ELFSQFDTDSSGSISLDEF---LIKIRPPMSE 497
           +LF+QFD D+S S++ DEF   L  I  PMS+
Sbjct: 609 DLFNQFDKDNSLSVTRDEFYTGLKGIGVPMSD 640


>SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 6406

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 21/66 (31%), Positives = 34/66 (51%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            IFRRMD D    L +E+F+ G+  T     + E E + S+F  + +G I   EF+  ++ 
Sbjct: 6040 IFRRMDHDRDGKLTREQFITGVLNTSFPTERWEMEIVASKF--ERNGLIDYKEFMNALKD 6097

Query: 486  PMSESR 503
              S  +
Sbjct: 6098 KPSAKK 6103


>SB_18942| Best HMM Match : efhand (HMM E-Value=1.7e-30)
          Length = 233

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 21/72 (29%), Positives = 32/72 (44%)
 Frame = +3

Query: 288 ILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           I  L  +F   D D S  ++  E    ++  G +++K     + +  D D SG I  DEF
Sbjct: 89  IRDLKLVFDTFDTDKSGSIDGRELRKAMRTLGFKISKEGIAGMIADLDADQSGRIEFDEF 148

Query: 468 LIKIRPPMSESR 503
           L  I    S+ R
Sbjct: 149 LDFIISKQSDGR 160


>SB_59144| Best HMM Match : efhand (HMM E-Value=0.093)
          Length = 240

 Score = 34.3 bits (75), Expect = 0.076
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSIS 455
           F+  D DG   + + +F+ GIK++GL+ +  E   L  Q D      +S
Sbjct: 69  FQEYDTDGLYKVTRADFVKGIKKSGLQFDIEETARLLKQLDPKKENLVS 117


>SB_37225| Best HMM Match : LRR_1 (HMM E-Value=2.6e-11)
          Length = 497

 Score = 33.9 bits (74), Expect = 0.10
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 7/80 (8%)
 Frame = +3

Query: 291 LGLGRIFRR--MDDD--GSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISL 458
           LG+    RR  MDDD    K+ +K + L  +KE  +E  +  A +LF+  D D S S+S 
Sbjct: 395 LGVSPTDRREAMDDDDKNGKMKSKNQLLTILKEYLIE-KRLRAVDLFNCLDKDKSRSVSP 453

Query: 459 DEF---LIKIRPPMSESRRK 509
           +E    L + R P+++S+ K
Sbjct: 454 EELIEGLKRARIPLTDSQLK 473


>SB_35284| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 195

 Score = 33.9 bits (74), Expect = 0.10
 Identities = 16/61 (26%), Positives = 29/61 (47%)
 Frame = +3

Query: 300 GRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           G +FR  D +    ++  EF+ G+        +++    F  +D+D SG +S  E L  +
Sbjct: 69  GHVFRTFDKNNDGTIDFNEFIQGLSIISRGSKETKLRWAFEIYDSDGSGEVSKKEMLEIV 128

Query: 480 R 482
           R
Sbjct: 129 R 129


>SB_13634| Best HMM Match : efhand (HMM E-Value=2e-24)
          Length = 176

 Score = 33.9 bits (74), Expect = 0.10
 Identities = 22/64 (34%), Positives = 35/64 (54%)
 Frame = +3

Query: 279 ASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISL 458
           A  I  LG+ FR++D D S  L+ EEF+  + E  L+ N    + + + FD D +G +  
Sbjct: 38  ADEIRRLGKRFRKLDLDNSGSLSVEEFM-SLPE--LQQNPL-VQRVITIFDADGNGEVDF 93

Query: 459 DEFL 470
            EF+
Sbjct: 94  KEFI 97


>SB_6736| Best HMM Match : efhand (HMM E-Value=2.6e-21)
          Length = 198

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 15/59 (25%), Positives = 29/59 (49%)
 Frame = +3

Query: 291 LGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           L L +IF+ +D+D S  ++  E    +K+  + L   + + +    D ++   I  DEF
Sbjct: 68  LRLEKIFQEIDEDNSGYIDHNEISNALKKLDINLPSRQIDGILKGMDLNNDNRIDFDEF 126


>SB_36414| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 299

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>SB_23229| Best HMM Match : efhand (HMM E-Value=6.8e-25)
          Length = 191

 Score = 33.1 bits (72), Expect = 0.18
 Identities = 17/59 (28%), Positives = 29/59 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L  +R
Sbjct: 68  VFRTFDANGDGTIDFREFICALSVTSRGKLEEKLKWAFSMYDLDGNGYISRQEMLEIVR 126


>SB_23228| Best HMM Match : efhand (HMM E-Value=6.8e-25)
          Length = 190

 Score = 33.1 bits (72), Expect = 0.18
 Identities = 17/59 (28%), Positives = 29/59 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           +FR  D +G   ++  EF+  +  T     + + +  FS +D D +G IS  E L  +R
Sbjct: 68  VFRTFDANGDGTIDFREFICALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVR 126


>SB_34261| Best HMM Match : efhand (HMM E-Value=5.3e-14)
          Length = 148

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 14/58 (24%), Positives = 26/58 (44%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L R+F   D D    +        + +  ++ N+SE E +    DT+  G +  +EF+
Sbjct: 85  LSRVFNEFDHDSKGYILPSNIRRVLIKFNIDPNESEIEHMMEAADTNEDGKVDFEEFM 142


>SB_49196| Best HMM Match : efhand (HMM E-Value=3.4e-39)
          Length = 659

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 15/64 (23%), Positives = 30/64 (46%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 6   FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 65

Query: 489 MSES 500
           M  +
Sbjct: 66  MKNT 69


>SB_44952| Best HMM Match : efhand (HMM E-Value=3.4e-39)
          Length = 250

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 15/64 (23%), Positives = 30/64 (46%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 6   FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 65

Query: 489 MSES 500
           M  +
Sbjct: 66  MKNT 69


>SB_7126| Best HMM Match : efhand (HMM E-Value=2e-26)
          Length = 213

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           FR  D DG+  ++  E  + +   G +L   E EE+  + D D  G ++ +
Sbjct: 54  FRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVEEMIMEADIDGDGQVNYE 104



 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/43 (25%), Positives = 22/43 (51%)
 Frame = +3

Query: 369 IKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSE 497
           ++  G    ++E +++ ++ D D +G I   EFL  +   M E
Sbjct: 1   MRSLGQNPTEAELQDMINEVDADGNGIIDFPEFLTMMAKKMGE 43


>SB_844| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 247

 Score = 32.3 bits (70), Expect = 0.31
 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 2/76 (2%)
 Frame = -3

Query: 272 GQAKQASFSRGSVACVIARALFCISSSSWTEPADIGLCHATELSISAFTFGE--FS*LKQ 99
           G+AKQ  FS+   A + A AL    SS  TE  + G C        A T  E  F+ +++
Sbjct: 95  GEAKQQEFSKIKKAIIQAPALAIYDSSKETESDNEGSCKTVAYLSRAITETEQRFAQIEK 154

Query: 98  AAIEALLILPRLKSIL 51
            A+   L   RL   L
Sbjct: 155 KALAVTLACERLSGYL 170


>SB_28695| Best HMM Match : Ras (HMM E-Value=0)
          Length = 1058

 Score = 32.3 bits (70), Expect = 0.31
 Identities = 17/56 (30%), Positives = 31/56 (55%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           +F   D D    + K + L+ +    L LN  + + +F+Q D D +G ++LDEF++
Sbjct: 428 LFYLCDSDRKGYITKTD-LHRVA-VDLSLNFDQLDLIFNQLDQDGNGRLTLDEFVL 481


>SB_23227| Best HMM Match : efhand (HMM E-Value=4.8e-26)
          Length = 776

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 15/55 (27%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EF+  +  T     + + +  F+ +D D +G IS  E L
Sbjct: 68  VFRTFDKNGDGTIDFREFICALSVTSRGKLEQKLKWAFNMYDLDGNGYISRQEML 122


>SB_53403| Best HMM Match : efhand (HMM E-Value=2.8e-12)
          Length = 146

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  DDD S  ++ +EF+  +  T       + E  F  +D ++ GSIS  E +
Sbjct: 67  VFRTFDDDRSGRIDFKEFMSSLSVTSRGNLDEKLEWAFRIYDINNDGSISRMEMI 121


>SB_43892| Best HMM Match : efhand (HMM E-Value=2.3e-11)
          Length = 353

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 19/55 (34%), Positives = 31/55 (56%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           F ++D +   L++ +EF   +    L +  +E EELF+ +D D SG I   E+LI
Sbjct: 283 FAKIDTNADGLVDIQEFAAFLN---LPIT-AEVEELFNLYDRDESGFIDFREYLI 333


>SB_31141| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 189

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 17/54 (31%), Positives = 29/54 (53%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           +F   D DGS  ++K+E          +L+  +  E+F++ D D  G IS++EF
Sbjct: 13  LFGTCDLDGSGYIDKQELA-----AVCDLDAEDLGEVFNKLDADRDGRISIEEF 61


>SB_11877| Best HMM Match : efhand (HMM E-Value=7.8e-07)
          Length = 390

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 11/21 (52%), Positives = 17/21 (80%)
 Frame = +3

Query: 411 ELFSQFDTDSSGSISLDEFLI 473
           ++F +FDTD+SG +S DEF +
Sbjct: 291 DVFKRFDTDNSGKLSYDEFFL 311


>SB_42267| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=5.9e-12)
          Length = 902

 Score = 31.1 bits (67), Expect = 0.71
 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFS--QFDTDSSGSISLDEFLIKIR 482
           F   D +    ++ +EFLY   ++ L L   + +++FS    D D++  +S +EF +   
Sbjct: 45  FNEWDTNSDGFIDIDEFLYLPGKSDLYLTDEDVKKMFSTLDIDHDNNDKMSFEEFSVVTA 104

Query: 483 PPMSESRRKL*NKHSRSLTR 542
             + +   +L    SR L+R
Sbjct: 105 ADIKKYFDQLRKYKSRLLSR 124



 Score = 29.1 bits (62), Expect = 2.9
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +3

Query: 387 ELNKSEAEELFSQFDTDSSGSISLDEFL 470
           E++     + F+++DT+S G I +DEFL
Sbjct: 35  EVSGETTRDTFNEWDTNSDGFIDIDEFL 62


>SB_8146| Best HMM Match : efhand (HMM E-Value=1.2e-16)
          Length = 285

 Score = 31.1 bits (67), Expect = 0.71
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIK 577
           +  AFK +DK GDG IT  D+K
Sbjct: 75  IRMAFKSMDKDGDGFITFGDLK 96


>SB_13209| Best HMM Match : LRR_1 (HMM E-Value=1.7e-13)
          Length = 489

 Score = 30.7 bits (66), Expect = 0.93
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
 Frame = +3

Query: 306 IFRRMDDDGS--KLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +F+R+D++      L + EF  G+K   + +N    ++L    DTD  G I   EF+
Sbjct: 431 LFKRLDENEQFRDSLTRAEFTEGMKRLKV-MNDYYLDKLVEMLDTDGDGEIDYSEFV 486


>SB_38608| Best HMM Match : Peptidase_C2 (HMM E-Value=0)
          Length = 842

 Score = 30.7 bits (66), Expect = 0.93
 Identities = 15/56 (26%), Positives = 31/56 (55%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +IF+  D+D S  ++  E    +KE G  L+ S    + +++ T   G +++D+F+
Sbjct: 714 KIFQVFDEDKSGEMDTYELRGALKEAGFTLSNSVLYAVSARYST-GDGKVNVDDFM 768


>SB_31565| Best HMM Match : efhand (HMM E-Value=3.4e-06)
          Length = 129

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 4/75 (5%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE---- 464
           LG ++  +D +G   L+  EF+ G      E  K+   ++F +FD   +G + L+     
Sbjct: 2   LGGLWNLLDVNGDGALDYGEFVRGFIGEMNETRKAYVRKVFHKFDPSKTGLVELNNMKKF 61

Query: 465 FLIKIRPPMSESRRK 509
           F  K  P +   R K
Sbjct: 62  FSAKKHPKVLSGRLK 76


>SB_16925| Best HMM Match : efhand (HMM E-Value=3e-22)
          Length = 132

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +3

Query: 399 SEAEELFSQFDTDSSGSISLDE 464
           +E  ++FS FD D+SGSI  DE
Sbjct: 3   NEMRDVFSMFDKDNSGSIDTDE 24


>SB_46583| Best HMM Match : Hus1 (HMM E-Value=0)
          Length = 646

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +2

Query: 488 HVGIAS*IVEQAFKKLDKTGDGAITIDDIKGCLL 589
           H+ I +    +AF   D+ GDG I  D I GCLL
Sbjct: 508 HLDIPTWEYREAFSLFDRVGDGKIECDQI-GCLL 540


>SB_11457| Best HMM Match : efhand (HMM E-Value=0.0066)
          Length = 219

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 17/57 (29%), Positives = 24/57 (42%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKI 479
           F      G  L+   +FL  I    L  ++   E  F   D D +  +S DEFL+ I
Sbjct: 56  FASCQAQGQCLMTPADFLESIVHEDLPESRRGIEIAFRMLDKDGNHELSKDEFLVFI 112


>SB_8159| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 767

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 17/67 (25%), Positives = 30/67 (44%)
 Frame = +3

Query: 282 SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           +G  G+ + FR  D  G   +++E F   +      ++ S    L  +   +S  SIS D
Sbjct: 55  TGFFGVRQAFRANDPRGRGSVSREAFTTILYHLCGYVSPSLVSSLLQRIGVESPSSISFD 114

Query: 462 EFLIKIR 482
           +F+   R
Sbjct: 115 DFISHFR 121


>SB_49265| Best HMM Match : efhand (HMM E-Value=0.68)
          Length = 720

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 16/56 (28%), Positives = 27/56 (48%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           ++F +     +  LN E+F   + E G+   K  A + F  FDT+  GS++    L
Sbjct: 329 KVFHKYVSPDASGLNCEQFTSLMSELGIAPQK--ATDFFRAFDTEKEGSVNYKRIL 382


>SB_50111| Best HMM Match : GCC2_GCC3 (HMM E-Value=0)
          Length = 1115

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 14/51 (27%), Positives = 21/51 (41%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSIS 455
           + FR  DDD S  ++        +E G  +   E   +  +FD D  G  S
Sbjct: 106 KAFRLFDDDDSGKISLRNLRRVARELGENMTDEELRAMIDEFDKDGDGENS 156


>SB_22463| Best HMM Match : VWA (HMM E-Value=0)
          Length = 1865

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +3

Query: 369  IKETGLELNKSEAEELFSQFDTDSSGS-ISLDEFLIKIRPPMSESRRK 509
            I ETG E  K+ A++L S FD  S+G+ I+L  +    +   S  R K
Sbjct: 936  IGETGFEYAKTFAKQLASAFDVSSNGAQIALISYGASAKADFSLKRYK 983


>SB_20284| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3307

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = +2

Query: 524  FKKLDKTGDGAITIDDIKGCLLCRF 598
            F++LD  GDG +  DD++  + C F
Sbjct: 1012 FQRLDFDGDGKVKEDDLRSLVFCDF 1036


>SB_59345| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1031

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNK-EEFLYGIKETGLELNKSEAEELF-SQFDTDSS 443
           F  + ++G KL+ K ++ LYG+KE+G   NK   E L  S F+ + S
Sbjct: 770 FEVIFENGEKLVYKLKKSLYGLKESGRNCNKLLHESLMESGFNRNPS 816


>SB_53082| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 476

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 14/54 (25%), Positives = 26/54 (48%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           ++RR+    S  L + +F  G+K   +++ + E  ELF   D +    +   EF
Sbjct: 399 LYRRLTRTDS--LREGDFAKGMKSMDIQMGERELRELFRFLDENDDKELQFSEF 450


>SB_43954| Best HMM Match : efhand (HMM E-Value=4.3e-23)
          Length = 308

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEF-LYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           R F   D +    L +EE  ++   E+  E+++    E     D D  G ISL EFL
Sbjct: 153 RRFDAADTNKDGFLTREEMAIFLHPESSPEMSEVHILETIEDIDRDKDGLISLKEFL 209


>SB_47001| Best HMM Match : Asparaginase_2 (HMM E-Value=2.5e-40)
          Length = 423

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 14/45 (31%), Positives = 27/45 (60%)
 Frame = +3

Query: 333 SKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           ++L +K E    +KE  +EL     EE+ +  + D+ G++++DEF
Sbjct: 245 TELQSKPEKREEVKEQDIELVLKMIEEIKNIDEHDTVGAVAIDEF 289


>SB_21457| Best HMM Match : efhand (HMM E-Value=1.7e-29)
          Length = 420

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIK 577
           ++ AFK  DK GDG I+  ++K
Sbjct: 365 IQDAFKVFDKNGDGMISSSELK 386


>SB_12096| Best HMM Match : ig (HMM E-Value=9.4e-33)
          Length = 942

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 17/46 (36%), Positives = 21/46 (45%)
 Frame = +3

Query: 327 DGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           D  KL  +EE  YG       + K   EELF   D  S  S+SL +
Sbjct: 64  DNLKLSMEEEEKYGFARQKSGILKRRQEELFEIADIQSPESMSLSQ 109


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,851,331
Number of Sequences: 59808
Number of extensions: 319212
Number of successful extensions: 960
Number of sequences better than 10.0: 54
Number of HSP's better than 10.0 without gapping: 830
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 952
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1439498375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).