SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0001
         (485 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092)               34   0.054
SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.7  
SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.2  
SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06)                  27   6.2  
SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0)                 27   8.2  
SB_12671| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.2  

>SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092)
          Length = 783

 Score = 34.3 bits (75), Expect = 0.054
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = -2

Query: 463 ENEKHRSNSELQY*AASRXHFPTSEPRQRTASRALEDRGATTRSEAQRAL 314
           E EK+  + EL+    S  HF   E ++R   RA+ED+    +SE ++ L
Sbjct: 332 EEEKYGKDGELRMLKESLAHFQAEEAKKREQIRAMEDQRKQEQSEKEKEL 381


>SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 516

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 20/67 (29%), Positives = 27/67 (40%)
 Frame = -1

Query: 425 LSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRSGTETAXLQTPSQ 246
           +S QSPT P     + +   S     C   +R   R   P   EER+  TET  +    +
Sbjct: 338 VSPQSPTQPQYYNKSTSFFDSI---SCEANDRDKNRKAHPSWQEERKLNTETFGVSGMRR 394

Query: 245 FSFGYGG 225
              GY G
Sbjct: 395 GRGGYRG 401


>SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1143

 Score = 27.9 bits (59), Expect = 4.7
 Identities = 15/47 (31%), Positives = 25/47 (53%)
 Frame = -1

Query: 422 SGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRS 282
           S +SP+ P  RTT   S ++S       + R++ R    +SS +RR+
Sbjct: 155 SSKSPSPPTNRTTQGESPKTSSSGHGQHSSRTAVRRSASFSSSQRRT 201


>SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 117

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = +1

Query: 337 ASWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 450
           A+W  G  E WRL  +     G++  W L ++   S G
Sbjct: 62  ATWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 99



 Score = 27.5 bits (58), Expect = 6.2
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = +1

Query: 337 ASWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 450
           A+W  G  E WRL  +     G++  W L ++   S G
Sbjct: 78  ATWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 115


>SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06)
          Length = 259

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = -3

Query: 228 RLTDHLTTASNGSDSSSRGTEYST 157
           RLT++  +ASNGSD  +   E ST
Sbjct: 2   RLTNYTLSASNGSDDETSNKEVST 25


>SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0)
          Length = 942

 Score = 27.1 bits (57), Expect = 8.2
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 1/72 (1%)
 Frame = -1

Query: 464 GKRKTPFEQR-VTILSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEER 288
           G+   P  QR V  ++G + T  +  T T + +  S  P+      SST+ L  +S    
Sbjct: 178 GQHAQPQSQRPVQSIAGSTATGQHA-TPTGHGIPPSSTPQARAPPHSSTQPLSSHSGSSP 236

Query: 287 RSGTETAXLQTP 252
           + G+  + + TP
Sbjct: 237 QPGSAFSPVNTP 248


>SB_12671| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 386

 Score = 27.1 bits (57), Expect = 8.2
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = +3

Query: 330 SLRVVAPRSSRALEAVRCRGSDVGKCXRLAA*YCNSLFERC 452
           ++RV+APR + A E      S+   C R AA   +   E C
Sbjct: 57  NIRVIAPRKATASELAAFHSSEYVNCMRRAAEAVSDGSEEC 97


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,086,244
Number of Sequences: 59808
Number of extensions: 244356
Number of successful extensions: 742
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 699
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 742
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1026164244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).