BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0245.Seq (906 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 78 1e-14 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 77 2e-14 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 5e-14 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 75 1e-13 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 75 1e-13 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 74 1e-13 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 74 1e-13 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 74 2e-13 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 74 2e-13 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 74 2e-13 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 73 2e-13 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 73 3e-13 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 73 3e-13 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 73 3e-13 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 73 3e-13 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 73 3e-13 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 73 3e-13 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 73 3e-13 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 73 3e-13 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 73 3e-13 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 73 3e-13 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 73 3e-13 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 73 3e-13 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 73 3e-13 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 73 3e-13 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 73 3e-13 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 73 3e-13 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 73 3e-13 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 73 3e-13 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 73 3e-13 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 73 3e-13 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 73 3e-13 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 73 3e-13 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 73 3e-13 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 73 3e-13 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 73 3e-13 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 73 3e-13 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 73 3e-13 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 73 3e-13 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 73 3e-13 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 73 3e-13 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 73 3e-13 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 73 3e-13 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 73 3e-13 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 73 3e-13 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 73 3e-13 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 73 3e-13 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 73 3e-13 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 73 3e-13 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 73 3e-13 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 73 3e-13 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 73 3e-13 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 73 3e-13 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 73 4e-13 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 72 6e-13 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 7e-13 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 72 7e-13 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 71 1e-12 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 71 1e-12 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 71 1e-12 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 71 1e-12 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 71 1e-12 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 71 1e-12 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 71 1e-12 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 71 1e-12 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 71 1e-12 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 71 1e-12 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 71 1e-12 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 71 1e-12 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 71 1e-12 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 71 1e-12 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 71 1e-12 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 71 1e-12 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 71 1e-12 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 71 1e-12 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 71 1e-12 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 71 1e-12 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 71 1e-12 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 71 1e-12 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 71 1e-12 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 71 1e-12 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 71 1e-12 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 71 1e-12 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 71 1e-12 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 71 1e-12 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 71 1e-12 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 71 1e-12 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 71 1e-12 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 71 1e-12 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 71 1e-12 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 71 1e-12 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 77.8 bits (183), Expect = 1e-14 Identities = 38/68 (55%), Positives = 43/68 (63%) Frame = +3 Query: 378 RGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXF 557 RGG P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 102 Query: 558 PTXAXLNG 581 LNG Sbjct: 103 QQLRSLNG 110 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 77.8 bits (183), Expect = 1e-14 Identities = 36/56 (64%), Positives = 40/56 (71%) Frame = +1 Query: 421 LQFHWPSFYNVVTGETXAXPXLIALQHIPLXQLGVIAKKAAPICXFQQXRX*MGEW 588 + HWPSFYNVVTG+T A P LIALQHIPL GVIAK+ API +Q R GEW Sbjct: 4 ITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 77.4 bits (182), Expect = 1e-14 Identities = 40/84 (47%), Positives = 50/84 (59%) Frame = +3 Query: 330 LTTAQFISYPIR*RHSRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPP 509 + ++ + +P R HS G P+ +++LAVVLQRRDW NPG T LNRLAAHPP Sbjct: 26 IASSAYQKWPTRNSHSLGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPP 82 Query: 510 XPAGRNSEEGRTDLXFPTXAXLNG 581 + RNSEE RTD LNG Sbjct: 83 FASWRNSEEARTDRPSQQLRSLNG 106 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/69 (53%), Positives = 44/69 (63%) Frame = +3 Query: 375 SRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLX 554 ++GG P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 50 AQGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 109 Query: 555 FPTXAXLNG 581 LNG Sbjct: 110 SQQLRSLNG 118 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 75.8 bits (178), Expect = 5e-14 Identities = 40/84 (47%), Positives = 49/84 (58%) Frame = +3 Query: 330 LTTAQFISYPIR*RHSRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPP 509 L T +S P+ + +G P+ +++LAVVLQRRDW NPG T LNRLAAHPP Sbjct: 173 LKTKSLLSSPMHEENPKGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPP 229 Query: 510 XPAGRNSEEGRTDLXFPTXAXLNG 581 + RNSEE RTD LNG Sbjct: 230 FASWRNSEEARTDRPSQQLRSLNG 253 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 74.9 bits (176), Expect = 8e-14 Identities = 37/67 (55%), Positives = 42/67 (62%) Frame = +3 Query: 381 GGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFP 560 G A P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 97 Query: 561 TXAXLNG 581 LNG Sbjct: 98 QLRSLNG 104 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 74.5 bits (175), Expect = 1e-13 Identities = 39/74 (52%), Positives = 45/74 (60%), Gaps = 3/74 (4%) Frame = +3 Query: 369 RHSRGG---AXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEG 539 R +GG A P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE Sbjct: 8 RREKGGQVSAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 67 Query: 540 RTDLXFPTXAXLNG 581 RTD LNG Sbjct: 68 RTDRPSQQLRSLNG 81 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 74.5 bits (175), Expect = 1e-13 Identities = 38/73 (52%), Positives = 44/73 (60%) Frame = +3 Query: 363 R*RHSRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGR 542 R +H A P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE R Sbjct: 153 RCQHEVAVAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 212 Query: 543 TDLXFPTXAXLNG 581 TD LNG Sbjct: 213 TDRPSQQLRSLNG 225 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 74.5 bits (175), Expect = 1e-13 Identities = 38/57 (66%), Positives = 40/57 (70%) Frame = +3 Query: 411 VSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLNG 581 +SRIT SLAVVLQRRDW N G T LNRLAAHPP + RNSEE RTD LNG Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 144 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 74.5 bits (175), Expect = 1e-13 Identities = 42/85 (49%), Positives = 50/85 (58%), Gaps = 2/85 (2%) Frame = +3 Query: 348 ISYPIR*RHSRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRN 527 IS R ++GG P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RN Sbjct: 27 ISIQARVGTAKGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRN 84 Query: 528 SEEGRTDLXFPTXAXLNG--RMANC 596 SEE RTD LNG R+ C Sbjct: 85 SEEARTDRPSQQLRSLNGEWRLMRC 109 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 74.1 bits (174), Expect = 1e-13 Identities = 37/68 (54%), Positives = 42/68 (61%) Frame = +3 Query: 378 RGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXF 557 RG P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 1 RGEYGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 60 Query: 558 PTXAXLNG 581 LNG Sbjct: 61 QQLRSLNG 68 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/73 (52%), Positives = 44/73 (60%), Gaps = 2/73 (2%) Frame = +3 Query: 369 RHSRGGAXY--PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGR 542 +H RG P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE R Sbjct: 14 QHIRGAGDLGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 73 Query: 543 TDLXFPTXAXLNG 581 TD LNG Sbjct: 74 TDRPSQQLRSLNG 86 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/76 (50%), Positives = 44/76 (57%) Frame = +3 Query: 375 SRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLX 554 S A P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 81 SNARAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 140 Query: 555 FPTXAXLNGRMANCKR 602 LNG +R Sbjct: 141 SQQLRSLNGEWRLMRR 156 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/73 (52%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = +3 Query: 369 RHSRGG--AXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGR 542 R +GG + P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE R Sbjct: 8 RREKGGQVSGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 67 Query: 543 TDLXFPTXAXLNG 581 TD LNG Sbjct: 68 TDRPSQQLRSLNG 80 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/73 (52%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = +3 Query: 369 RHSRGG--AXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGR 542 R +GG + P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE R Sbjct: 8 RREKGGQVSGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 67 Query: 543 TDLXFPTXAXLNG 581 TD LNG Sbjct: 68 TDRPSQQLRSLNG 80 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 74.1 bits (174), Expect = 1e-13 Identities = 37/71 (52%), Positives = 44/71 (61%), Gaps = 2/71 (2%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 158 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 217 Query: 576 NG--RMANCKR 602 NG R+ C + Sbjct: 218 NGEWRLMRCDK 228 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 74.1 bits (174), Expect = 1e-13 Identities = 37/69 (53%), Positives = 42/69 (60%) Frame = +3 Query: 375 SRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLX 554 S G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 41 SLNGEGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 100 Query: 555 FPTXAXLNG 581 LNG Sbjct: 101 SQQLRSLNG 109 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 489 RLAAHPPXPAGRNSEEGRTDLXFPTXAXLNG 581 +++AHPP + RNSEE RTD LNG Sbjct: 14 QVSAHPPFASWRNSEEARTDRPSQQLRSLNG 44 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 74.1 bits (174), Expect = 1e-13 Identities = 37/67 (55%), Positives = 41/67 (61%) Frame = +3 Query: 381 GGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFP 560 G YP +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 17 GYIKYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 76 Query: 561 TXAXLNG 581 LNG Sbjct: 77 QLRSLNG 83 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 73.7 bits (173), Expect = 2e-13 Identities = 39/73 (53%), Positives = 44/73 (60%), Gaps = 2/73 (2%) Frame = +3 Query: 369 RHSRG--GAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGR 542 R S G A P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE R Sbjct: 17 RRSNGPVAAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 76 Query: 543 TDLXFPTXAXLNG 581 TD LNG Sbjct: 77 TDRPSQQLRSLNG 89 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 73.7 bits (173), Expect = 2e-13 Identities = 38/71 (53%), Positives = 44/71 (61%) Frame = +3 Query: 369 RHSRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTD 548 RH + G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 69 RHRKFGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 126 Query: 549 LXFPTXAXLNG 581 LNG Sbjct: 127 RPSQQLRSLNG 137 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 73.7 bits (173), Expect = 2e-13 Identities = 38/68 (55%), Positives = 43/68 (63%) Frame = +3 Query: 378 RGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXF 557 RGG P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 84 RGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 141 Query: 558 PTXAXLNG 581 LNG Sbjct: 142 QQLRSLNG 149 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 73.7 bits (173), Expect = 2e-13 Identities = 38/71 (53%), Positives = 44/71 (61%) Frame = +3 Query: 369 RHSRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTD 548 R S+G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 1170 RRSQGKGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 1228 Query: 549 LXFPTXAXLNG 581 LNG Sbjct: 1229 RPSQQLRSLNG 1239 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 73.7 bits (173), Expect = 2e-13 Identities = 39/79 (49%), Positives = 47/79 (59%) Frame = +3 Query: 345 FISYPIR*RHSRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGR 524 +I +P H+ G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + R Sbjct: 13 YIPHPAVPLHTGGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWR 69 Query: 525 NSEEGRTDLXFPTXAXLNG 581 NSEE RTD LNG Sbjct: 70 NSEEARTDRPSQQLRSLNG 88 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 73.7 bits (173), Expect = 2e-13 Identities = 36/66 (54%), Positives = 41/66 (62%) Frame = +3 Query: 384 GAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPT 563 G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 147 Query: 564 XAXLNG 581 LNG Sbjct: 148 LRSLNG 153 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 73.7 bits (173), Expect = 2e-13 Identities = 45/115 (39%), Positives = 58/115 (50%), Gaps = 1/115 (0%) Frame = +3 Query: 240 FGLRKM*GXVSLTTLVIKYIKFPNSEYFX*LTTAQFIS-YPIR*RHSRGGAXYPIRPIVS 416 +GL G L +K K P+++ + + YP + G P+ Sbjct: 31 YGLPNRYGSTRLLRKAVKNPKAPSTDISERICCTTLLQGYPNPRINGEDGD--PLESTCR 88 Query: 417 RITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLNG 581 +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD LNG Sbjct: 89 HASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 143 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 73.7 bits (173), Expect = 2e-13 Identities = 36/66 (54%), Positives = 41/66 (62%) Frame = +3 Query: 384 GAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPT 563 G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 703 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 762 Query: 564 XAXLNG 581 LNG Sbjct: 763 LRSLNG 768 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 73.7 bits (173), Expect = 2e-13 Identities = 36/69 (52%), Positives = 43/69 (62%) Frame = +3 Query: 375 SRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLX 554 ++G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 17 AKGTKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 76 Query: 555 FPTXAXLNG 581 LNG Sbjct: 77 SQQLRSLNG 85 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 73.3 bits (172), Expect = 2e-13 Identities = 39/77 (50%), Positives = 46/77 (59%) Frame = +3 Query: 351 SYPIR*RHSRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNS 530 S+P+ R G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNS Sbjct: 8 SFPVTPRIQSYGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 65 Query: 531 EEGRTDLXFPTXAXLNG 581 EE RTD LNG Sbjct: 66 EEARTDRPSQQLRSLNG 82 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/66 (54%), Positives = 41/66 (62%) Frame = +3 Query: 384 GAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPT 563 G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 68 GRGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 127 Query: 564 XAXLNG 581 LNG Sbjct: 128 LRSLNG 133 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 73.3 bits (172), Expect = 2e-13 Identities = 38/71 (53%), Positives = 44/71 (61%) Frame = +3 Query: 369 RHSRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTD 548 RH+ G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 66 RHAFGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 122 Query: 549 LXFPTXAXLNG 581 LNG Sbjct: 123 RPSQQLRSLNG 133 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/66 (54%), Positives = 41/66 (62%) Frame = +3 Query: 384 GAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPT 563 G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 49 GRGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 108 Query: 564 XAXLNG 581 LNG Sbjct: 109 LRSLNG 114 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 73.3 bits (172), Expect = 2e-13 Identities = 38/71 (53%), Positives = 43/71 (60%) Frame = +3 Query: 369 RHSRGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTD 548 RH G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 43 RHDAQGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 100 Query: 549 LXFPTXAXLNG 581 LNG Sbjct: 101 RPSQQLRSLNG 111 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/68 (52%), Positives = 42/68 (61%) Frame = +3 Query: 378 RGGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXF 557 +G P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 3 KGEEGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 62 Query: 558 PTXAXLNG 581 LNG Sbjct: 63 QQLRSLNG 70 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 109 Query: 576 NG 581 NG Sbjct: 110 NG 111 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 72 Query: 576 NG 581 NG Sbjct: 73 NG 74 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 96 Query: 576 NG 581 NG Sbjct: 97 NG 98 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 75 Query: 576 NG 581 NG Sbjct: 76 NG 77 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 17 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 76 Query: 576 NG 581 NG Sbjct: 77 NG 78 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 65 Query: 576 NG 581 NG Sbjct: 66 NG 67 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 821 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 880 Query: 576 NG 581 NG Sbjct: 881 NG 882 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 102 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 161 Query: 576 NG 581 NG Sbjct: 162 NG 163 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 86 Query: 576 NG 581 NG Sbjct: 87 NG 88 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 67 Query: 576 NG 581 NG Sbjct: 68 NG 69 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 84 Query: 576 NG 581 NG Sbjct: 85 NG 86 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 135 Query: 576 NG 581 NG Sbjct: 136 NG 137 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 120 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 179 Query: 576 NG 581 NG Sbjct: 180 NG 181 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 Query: 576 NG 581 NG Sbjct: 70 NG 71 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 141 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 200 Query: 576 NG 581 NG Sbjct: 201 NG 202 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 104 Query: 576 NG 581 NG Sbjct: 105 NG 106 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 68 Query: 576 NG 581 NG Sbjct: 69 NG 70 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 107 Query: 576 NG 581 NG Sbjct: 108 NG 109 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 95 Query: 576 NG 581 NG Sbjct: 96 NG 97 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 63 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 122 Query: 576 NG 581 NG Sbjct: 123 NG 124 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 Query: 576 NG 581 NG Sbjct: 70 NG 71 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 104 Query: 576 NG 581 NG Sbjct: 105 NG 106 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 120 Query: 576 NG 581 NG Sbjct: 121 NG 122 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 75 Query: 576 NG 581 NG Sbjct: 76 NG 77 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 193 Query: 576 NG 581 NG Sbjct: 194 NG 195 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 106 Query: 576 NG 581 NG Sbjct: 107 NG 108 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 113 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 172 Query: 576 NG 581 NG Sbjct: 173 NG 174 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 65 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 124 Query: 576 NG 581 NG Sbjct: 125 NG 126 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 81 Query: 576 NG 581 NG Sbjct: 82 NG 83 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 83 Query: 576 NG 581 NG Sbjct: 84 NG 85 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 84 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 143 Query: 576 NG 581 NG Sbjct: 144 NG 145 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 49 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 108 Query: 576 NG 581 NG Sbjct: 109 NG 110 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 87 Query: 576 NG 581 NG Sbjct: 88 NG 89 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 131 Query: 576 NG 581 NG Sbjct: 132 NG 133 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 68 Query: 576 NG 581 NG Sbjct: 69 NG 70 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 112 Query: 576 NG 581 NG Sbjct: 113 NG 114 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 71 Query: 576 NG 581 NG Sbjct: 72 NG 73 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 96 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 155 Query: 576 NG 581 NG Sbjct: 156 NG 157 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 71 Query: 576 NG 581 NG Sbjct: 72 NG 73 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 90 Query: 576 NG 581 NG Sbjct: 91 NG 92 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 64 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 123 Query: 576 NG 581 NG Sbjct: 124 NG 125 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 114 Query: 576 NG 581 NG Sbjct: 115 NG 116 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 79 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 138 Query: 576 NG 581 NG Sbjct: 139 NG 140 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 88 Query: 576 NG 581 NG Sbjct: 89 NG 90 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 1051 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 1110 Query: 576 NG 581 NG Sbjct: 1111 NG 1112 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 64 Query: 576 NG 581 NG Sbjct: 65 NG 66 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 122 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 181 Query: 576 NG 581 NG Sbjct: 182 NG 183 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 170 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 229 Query: 576 NG 581 NG Sbjct: 230 NG 231 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 106 Query: 576 NG 581 NG Sbjct: 107 NG 108 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 66 Query: 576 NG 581 NG Sbjct: 67 NG 68 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 193 Query: 576 NG 581 NG Sbjct: 194 NG 195 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 105 Query: 576 NG 581 NG Sbjct: 106 NG 107 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 104 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 163 Query: 576 NG 581 NG Sbjct: 164 NG 165 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 11 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 70 Query: 576 NG 581 NG Sbjct: 71 NG 72 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 640 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 699 Query: 576 NG 581 NG Sbjct: 700 NG 701 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 149 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 208 Query: 576 NG 581 NG Sbjct: 209 NG 210 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 35 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 94 Query: 576 NG 581 NG Sbjct: 95 NG 96 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 79 Query: 576 NG 581 NG Sbjct: 80 NG 81 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 Query: 576 NG 581 NG Sbjct: 70 NG 71 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 105 Query: 576 NG 581 NG Sbjct: 106 NG 107 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 117 Query: 576 NG 581 NG Sbjct: 118 NG 119 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 64 Query: 576 NG 581 NG Sbjct: 65 NG 66 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 59 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 118 Query: 576 NG 581 NG Sbjct: 119 NG 120 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 126 Query: 576 NG 581 NG Sbjct: 127 NG 128 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 173 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 232 Query: 576 NG 581 NG Sbjct: 233 NG 234 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 120 Query: 576 NG 581 NG Sbjct: 121 NG 122 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 254 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 313 Query: 576 NG 581 NG Sbjct: 314 NG 315 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 67 Query: 576 NG 581 NG Sbjct: 68 NG 69 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 81 Query: 576 NG 581 NG Sbjct: 82 NG 83 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 117 Query: 576 NG 581 NG Sbjct: 118 NG 119 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 92 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 151 Query: 576 NG 581 NG Sbjct: 152 NG 153 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 110 Query: 576 NG 581 NG Sbjct: 111 NG 112 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 120 Query: 576 NG 581 NG Sbjct: 121 NG 122 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 120 Query: 576 NG 581 NG Sbjct: 121 NG 122 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 64 Query: 576 NG 581 NG Sbjct: 65 NG 66 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 62 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 121 Query: 576 NG 581 NG Sbjct: 122 NG 123 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 130 Query: 576 NG 581 NG Sbjct: 131 NG 132 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 78 Query: 576 NG 581 NG Sbjct: 79 NG 80 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 130 Query: 576 NG 581 NG Sbjct: 131 NG 132 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 67 Query: 576 NG 581 NG Sbjct: 68 NG 69 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 96 Query: 576 NG 581 NG Sbjct: 97 NG 98 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 120 Query: 576 NG 581 NG Sbjct: 121 NG 122 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 130 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 189 Query: 576 NG 581 NG Sbjct: 190 NG 191 >SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 75 Query: 576 NG 581 NG Sbjct: 76 NG 77 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 56 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 115 Query: 576 NG 581 NG Sbjct: 116 NG 117 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 104 Query: 576 NG 581 NG Sbjct: 105 NG 106 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 116 Query: 576 NG 581 NG Sbjct: 117 NG 118 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 67 Query: 576 NG 581 NG Sbjct: 68 NG 69 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 85 Query: 576 NG 581 NG Sbjct: 86 NG 87 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 91 Query: 576 NG 581 NG Sbjct: 92 NG 93 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTL 86 Query: 576 NG 581 NG Sbjct: 87 NG 88 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 109 Query: 576 NG 581 NG Sbjct: 110 NG 111 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 128 Query: 576 NG 581 NG Sbjct: 129 NG 130 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 179 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 238 Query: 576 NG 581 NG Sbjct: 239 NG 240 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 75 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 134 Query: 576 NG 581 NG Sbjct: 135 NG 136 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 85 Query: 576 NG 581 NG Sbjct: 86 NG 87 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 38 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 97 Query: 576 NG 581 NG Sbjct: 98 NG 99 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 96 Query: 576 NG 581 NG Sbjct: 97 NG 98 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 88 Query: 576 NG 581 NG Sbjct: 89 NG 90 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 Query: 576 NG 581 NG Sbjct: 70 NG 71 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 67 Query: 576 NG 581 NG Sbjct: 68 NG 69 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 173 Query: 576 NG 581 NG Sbjct: 174 NG 175 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 90 Query: 576 NG 581 NG Sbjct: 91 NG 92 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 116 Query: 576 NG 581 NG Sbjct: 117 NG 118 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 65 Query: 576 NG 581 NG Sbjct: 66 NG 67 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 101 Query: 576 NG 581 NG Sbjct: 102 NG 103 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 135 Query: 576 NG 581 NG Sbjct: 136 NG 137 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 102 Query: 576 NG 581 NG Sbjct: 103 NG 104 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 105 Query: 576 NG 581 NG Sbjct: 106 NG 107 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 67 Query: 576 NG 581 NG Sbjct: 68 NG 69 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 155 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 214 Query: 576 NG 581 NG Sbjct: 215 NG 216 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 30 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 89 Query: 576 NG 581 NG Sbjct: 90 NG 91 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 64 Query: 576 NG 581 NG Sbjct: 65 NG 66 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 80 Query: 576 NG 581 NG Sbjct: 81 NG 82 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 126 Query: 576 NG 581 NG Sbjct: 127 NG 128 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 81 Query: 576 NG 581 NG Sbjct: 82 NG 83 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 93 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 152 Query: 576 NG 581 NG Sbjct: 153 NG 154 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 34 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 93 Query: 576 NG 581 NG Sbjct: 94 NG 95 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 83 Query: 576 NG 581 NG Sbjct: 84 NG 85 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 107 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 166 Query: 576 NG 581 NG Sbjct: 167 NG 168 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 140 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 199 Query: 576 NG 581 NG Sbjct: 200 NG 201 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 90 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 149 Query: 576 NG 581 NG Sbjct: 150 NG 151 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 81 Query: 576 NG 581 NG Sbjct: 82 NG 83 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 73 Query: 576 NG 581 NG Sbjct: 74 NG 75 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 102 Query: 576 NG 581 NG Sbjct: 103 NG 104 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 84 Query: 576 NG 581 NG Sbjct: 85 NG 86 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 103 Query: 576 NG 581 NG Sbjct: 104 NG 105 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 144 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 203 Query: 576 NG 581 NG Sbjct: 204 NG 205 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 116 Query: 576 NG 581 NG Sbjct: 117 NG 118 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 173 Query: 576 NG 581 NG Sbjct: 174 NG 175 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 105 Query: 576 NG 581 NG Sbjct: 106 NG 107 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 77 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 136 Query: 576 NG 581 NG Sbjct: 137 NG 138 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 65 Query: 576 NG 581 NG Sbjct: 66 NG 67 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 73 Query: 576 NG 581 NG Sbjct: 74 NG 75 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 59 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 118 Query: 576 NG 581 NG Sbjct: 119 NG 120 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 132 Query: 576 NG 581 NG Sbjct: 133 NG 134 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 91 Query: 576 NG 581 NG Sbjct: 92 NG 93 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 140 Query: 576 NG 581 NG Sbjct: 141 NG 142 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 127 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 186 Query: 576 NG 581 NG Sbjct: 187 NG 188 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 133 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 192 Query: 576 NG 581 NG Sbjct: 193 NG 194 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 60 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 119 Query: 576 NG 581 NG Sbjct: 120 NG 121 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 140 Query: 576 NG 581 NG Sbjct: 141 NG 142 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 102 Query: 576 NG 581 NG Sbjct: 103 NG 104 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 95 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 154 Query: 576 NG 581 NG Sbjct: 155 NG 156 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 128 Query: 576 NG 581 NG Sbjct: 129 NG 130 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 96 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 155 Query: 576 NG 581 NG Sbjct: 156 NG 157 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 294 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 353 Query: 576 NG 581 NG Sbjct: 354 NG 355 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 77 Query: 576 NG 581 NG Sbjct: 78 NG 79 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 40 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 99 Query: 576 NG 581 NG Sbjct: 100 NG 101 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 3 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 62 Query: 576 NG 581 NG Sbjct: 63 NG 64 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 73 Query: 576 NG 581 NG Sbjct: 74 NG 75 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 72.9 bits (171), Expect = 3e-13 Identities = 41/70 (58%), Positives = 43/70 (61%), Gaps = 4/70 (5%) Frame = +3 Query: 384 GAXYPIRPIVSRITIS----LAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDL 551 G YP P SR + S LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 42 GLNYPFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 101 Query: 552 XFPTXAXLNG 581 LNG Sbjct: 102 PSQQLRSLNG 111 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 103 Query: 576 NG 581 NG Sbjct: 104 NG 105 >SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 72 Query: 576 NG 581 NG Sbjct: 73 NG 74 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 235 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 294 Query: 576 NG 581 NG Sbjct: 295 NG 296 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 128 Query: 576 NG 581 NG Sbjct: 129 NG 130 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 95 Query: 576 NG 581 NG Sbjct: 96 NG 97 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 71 Query: 576 NG 581 NG Sbjct: 72 NG 73 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 110 Query: 576 NG 581 NG Sbjct: 111 NG 112 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 65 Query: 576 NG 581 NG Sbjct: 66 NG 67 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 23 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 82 Query: 576 NG 581 NG Sbjct: 83 NG 84 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 86 Query: 576 NG 581 NG Sbjct: 87 NG 88 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 517 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 576 Query: 576 NG 581 NG Sbjct: 577 NG 578 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 84 Query: 576 NG 581 NG Sbjct: 85 NG 86 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 66 Query: 576 NG 581 NG Sbjct: 67 NG 68 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 77 Query: 576 NG 581 NG Sbjct: 78 NG 79 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 67 Query: 576 NG 581 NG Sbjct: 68 NG 69 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 132 Query: 576 NG 581 NG Sbjct: 133 NG 134 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 79 Query: 576 NG 581 NG Sbjct: 80 NG 81 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 97 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 156 Query: 576 NG 581 NG Sbjct: 157 NG 158 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 84 Query: 576 NG 581 NG Sbjct: 85 NG 86 >SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 88 Query: 576 NG 581 NG Sbjct: 89 NG 90 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 186 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 245 Query: 576 NG 581 NG Sbjct: 246 NG 247 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 107 Query: 576 NG 581 NG Sbjct: 108 NG 109 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 68 Query: 576 NG 581 NG Sbjct: 69 NG 70 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 73 Query: 576 NG 581 NG Sbjct: 74 NG 75 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 15 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 74 Query: 576 NG 581 NG Sbjct: 75 NG 76 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 67 Query: 576 NG 581 NG Sbjct: 68 NG 69 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 114 Query: 576 NG 581 NG Sbjct: 115 NG 116 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 71 Query: 576 NG 581 NG Sbjct: 72 NG 73 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 91 Query: 576 NG 581 NG Sbjct: 92 NG 93 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 109 Query: 576 NG 581 NG Sbjct: 110 NG 111 >SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 87 Query: 576 NG 581 NG Sbjct: 88 NG 89 >SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 67 Query: 576 NG 581 NG Sbjct: 68 NG 69 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 109 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 168 Query: 576 NG 581 NG Sbjct: 169 NG 170 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 352 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 411 Query: 576 NG 581 NG Sbjct: 412 NG 413 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 88 Query: 576 NG 581 NG Sbjct: 89 NG 90 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 101 Query: 576 NG 581 NG Sbjct: 102 NG 103 >SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 63 Query: 576 NG 581 NG Sbjct: 64 NG 65 >SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 128 Query: 576 NG 581 NG Sbjct: 129 NG 130 >SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/62 (56%), Positives = 40/62 (64%) Frame = +3 Query: 396 PIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXL 575 P+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD L Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 78 Query: 576 NG 581 NG Sbjct: 79 NG 80 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 72.5 bits (170), Expect = 4e-13 Identities = 36/67 (53%), Positives = 41/67 (61%) Frame = +3 Query: 381 GGAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFP 560 G A + +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD Sbjct: 98 GNACRHVESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 157 Query: 561 TXAXLNG 581 LNG Sbjct: 158 QLRSLNG 164 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.1 bits (169), Expect = 6e-13 Identities = 41/79 (51%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Frame = +3 Query: 351 SYPIR*RHSRG--GAXYPIRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGR 524 SY IR R R G P+ +++L VVLQRRDW NPG T LNRLAAHPP + R Sbjct: 19 SYRIR-RSGRAERGVGDPLESSCRHASLALDVVLQRRDWENPGVTQLNRLAAHPPFASWR 77 Query: 525 NSEEGRTDLXFPTXAXLNG 581 NSEE RTD LNG Sbjct: 78 NSEEARTDRPSQQLRSLNG 96 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 72.1 bits (169), Expect = 6e-13 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 2/62 (3%) Frame = +3 Query: 423 TISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLNG--RMANC 596 +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD LNG R+ Sbjct: 48 SLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRT 107 Query: 597 KR 602 KR Sbjct: 108 KR 109 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.1 bits (169), Expect = 6e-13 Identities = 35/52 (67%), Positives = 37/52 (71%) Frame = +3 Query: 429 SLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLNGR 584 SLAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD LNG+ Sbjct: 38 SLAVVLQRRDWKNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLLSLNGK 89 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 71.7 bits (168), Expect = 7e-13 Identities = 36/57 (63%), Positives = 38/57 (66%) Frame = +3 Query: 411 VSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLNG 581 +SRITI VLQRRDW NPG T LNRLAAHPP + RNSEE RTD LNG Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 333 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 71.7 bits (168), Expect = 7e-13 Identities = 35/61 (57%), Positives = 40/61 (65%) Frame = +3 Query: 399 IRPIVSRITISLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLN 578 I+ +++LAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD LN Sbjct: 433 IKSTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 492 Query: 579 G 581 G Sbjct: 493 G 493 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 71.3 bits (167), Expect = 1e-12 Identities = 35/51 (68%), Positives = 36/51 (70%) Frame = +3 Query: 429 SLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLNG 581 SLAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD LNG Sbjct: 34 SLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 84 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 71.3 bits (167), Expect = 1e-12 Identities = 35/51 (68%), Positives = 36/51 (70%) Frame = +3 Query: 429 SLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLNG 581 SLAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD LNG Sbjct: 28 SLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 78 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 71.3 bits (167), Expect = 1e-12 Identities = 35/51 (68%), Positives = 36/51 (70%) Frame = +3 Query: 429 SLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLNG 581 SLAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD LNG Sbjct: 43 SLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 93 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 71.3 bits (167), Expect = 1e-12 Identities = 35/51 (68%), Positives = 36/51 (70%) Frame = +3 Query: 429 SLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLNG 581 SLAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD LNG Sbjct: 35 SLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 85 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 71.3 bits (167), Expect = 1e-12 Identities = 35/51 (68%), Positives = 36/51 (70%) Frame = +3 Query: 429 SLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLNG 581 SLAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD LNG Sbjct: 61 SLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 111 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 71.3 bits (167), Expect = 1e-12 Identities = 35/51 (68%), Positives = 36/51 (70%) Frame = +3 Query: 429 SLAVVLQRRDWGNPGGTXLNRLAAHPPXPAGRNSEEGRTDLXFPTXAXLNG 581 SLAVVLQRRDW NPG T LNRLAAHPP + RNSEE RTD LNG Sbjct: 66 SLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 116 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,040,990 Number of Sequences: 59808 Number of extensions: 383990 Number of successful extensions: 6226 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6182 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -