BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0241.Seq (534 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) 43 2e-04 SB_27851| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.063 SB_41923| Best HMM Match : Lentiviral_Tat (HMM E-Value=3.8) 31 0.59 SB_50778| Best HMM Match : PA14 (HMM E-Value=0.00025) 29 3.2 >SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) Length = 482 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -2 Query: 173 EETIRLGGSMVHHHGIGKHRVXW-SKLEHGSAWALLEGLKKQFDPNGIMNTG 21 +E + GGS+ HHHG+GK R W K +L+ +K+ DP I G Sbjct: 428 DEILANGGSLSHHHGVGKLRKKWLPKTVSNVGMEMLKAVKRAIDPKNIFGNG 479 >SB_27851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 34.3 bits (75), Expect = 0.063 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = -2 Query: 239 VVDCKPEEEIDKYHXPLNKIICEETIRLGGSMVHHHGIGKHRVXWSKLEHG-SAWALLEG 63 V+D E+EI + + +GG+ HGIG+ ++ + E G S +++ Sbjct: 281 VIDTSNEKEIQNAKD-FTLRLGRRALAVGGTCTGEHGIGRGKLALLEEEVGPSGIEVMKQ 339 Query: 62 LKKQFDPNGIMNTGYYL 12 +K+ DP +MN G L Sbjct: 340 IKQMLDPKNLMNPGKVL 356 >SB_41923| Best HMM Match : Lentiviral_Tat (HMM E-Value=3.8) Length = 450 Score = 31.1 bits (67), Expect = 0.59 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 4/83 (4%) Frame = -2 Query: 245 YNVVDCKPEEEIDKYHXPLN-KIICEE---TIRLGGSMVHHHGIGKHRVXWSKLEHGSAW 78 Y +P ++DK H +N K+IC + ++ + KH+ W ++G+ W Sbjct: 78 YRTKGRQPLTKLDKLHLAINPKMICTKRPPSVEEDMKFIVDRSKLKHKGDWLVTDNGTFW 137 Query: 77 ALLEGLKKQFDPNGIMNTGYYLS 9 L LK +G + GY +S Sbjct: 138 NLGNSLKVYKIKDGKVINGYMMS 160 >SB_50778| Best HMM Match : PA14 (HMM E-Value=0.00025) Length = 1266 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 278 SERHQHV--LVYDYNVVDCKPEEEIDKYHXPLNKII 177 S R QHV +VYDY D E E+ K P K+I Sbjct: 1079 SSRDQHVSLIVYDYESEDLDIERELSKRSLPPYKLI 1114 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,866,773 Number of Sequences: 59808 Number of extensions: 267700 Number of successful extensions: 716 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -