BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0237.Seq (907 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_42487| Best HMM Match : Extensin_2 (HMM E-Value=0.084) 29 6.8 SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_910| Best HMM Match : Cation_efflux (HMM E-Value=0.056) 28 9.0 >SB_33023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 29.1 bits (62), Expect = 5.2 Identities = 26/89 (29%), Positives = 36/89 (40%), Gaps = 1/89 (1%) Frame = -1 Query: 523 KFIAGDFFDKPPASGGDGAAAHTASAPYQYRPDGLRCDKHRCQKSAFHNADKTEKLTVFF 344 +F+ GD D P G G AH A Y + GL D H + F +T+ F Sbjct: 177 RFVTGDHGDGYPFDGPGGTLAH---AFYPHDNTGLSGDAHFDDEEYF--TLRTDHGIDLF 231 Query: 343 PDPVLRVG-KIGIPHQRNAVTPVIRFYKG 260 V G +G+ H N + FY+G Sbjct: 232 WVAVHEFGHSLGLDHSSNVDAIMYPFYRG 260 >SB_42487| Best HMM Match : Extensin_2 (HMM E-Value=0.084) Length = 635 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 657 WLEKYNGPELTLTAFEPPASS*SMWVVGFHPAMRNRQCENPVP 529 W+ + + P AF PP+ S V FHPA +R+ +P Sbjct: 100 WIFRDSIPRDLTDAFTPPSRGISQTCVPFHPAESHRRVYPSIP 142 >SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 28.7 bits (61), Expect = 6.8 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 5/68 (7%) Frame = +3 Query: 450 DAVCAAAPSPPDAGGLSKKS-----PAINFYQAQGFHIVDCAWQDETQLPTWIMSWPVVQ 614 D VC PP +KK+ + A G ++DC + T LPT WP + Sbjct: 640 DRVCHPVIEPPPPSTTTKKTIITTLTTMRICAANG-PLIDCFYNYSTTLPTHPWIWPPMS 698 Query: 615 TL*VSVPD 638 T S PD Sbjct: 699 T---STPD 703 >SB_910| Best HMM Match : Cation_efflux (HMM E-Value=0.056) Length = 416 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 Query: 186 WFISRIATAANHMIIHQPTCLHK 118 W I R+ +HQP CLHK Sbjct: 247 WVIRRVNATTKPKNLHQPLCLHK 269 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,021,447 Number of Sequences: 59808 Number of extensions: 762594 Number of successful extensions: 1783 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1781 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -