BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0227.Seq (928 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_53075| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 57 DVVAVSQAPSPESNPDSPLPVTTM 128 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +3 Query: 66 AVSQAPSPESNPDSPLPVTTM 128 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.081 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 67 PFLRLPLRNRTLIPRYP 117 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_53075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -1 Query: 331 ELIHAIRTLTSDGMSAFIRSKPIDGGLASEVVNFDES 221 +L+HA++ G S+++ + PI+ GLA F +S Sbjct: 125 DLLHAVQQTRDKGASSWLNATPIEYGLALNKEEFGDS 161 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,901,809 Number of Sequences: 59808 Number of extensions: 538379 Number of successful extensions: 1132 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1131 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2693287426 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -