BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0220.Seq (903 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 61 1e-09 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 56 5e-08 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 50 3e-06 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 49 4e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 48 8e-06 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 41 0.001 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 36 0.045 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 35 0.10 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 34 0.14 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 33 0.42 SB_51385| Best HMM Match : DEAD (HMM E-Value=0.00031) 32 0.55 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 32 0.55 SB_34740| Best HMM Match : DEAD (HMM E-Value=0.00031) 32 0.55 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 31 1.7 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 31 1.7 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 31 1.7 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 30 2.9 SB_51151| Best HMM Match : Vicilin_N (HMM E-Value=0.19) 29 3.9 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 29 5.1 SB_41425| Best HMM Match : DCX (HMM E-Value=8.6e-06) 29 6.8 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 28 9.0 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 72.1 bits (169), Expect = 6e-13 Identities = 31/89 (34%), Positives = 48/89 (53%) Frame = +1 Query: 241 PRLGFVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPD 420 P + +PFNKNFY+ HP + K+S E+++ R + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 421 YVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 + ++ + Y +PT IQ Q PIA+SG+ Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGR 555 Score = 59.7 bits (138), Expect = 3e-09 Identities = 23/41 (56%), Positives = 34/41 (82%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALV 626 +D++G+ KTGSGKT A++ PA+VHI +QP ++ GDGPI L+ Sbjct: 555 RDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLI 595 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = +1 Query: 313 RSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 480 R +EV+ YR + ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 Score = 48.8 bits (111), Expect = 6e-06 Identities = 31/77 (40%), Positives = 41/77 (53%) Frame = +3 Query: 552 YILPAIVHINNQPPIRRGDGPIALVLGGLXES*HNKFQQVAADFGXHILCS*HVCVWWWF 731 +ILP IVHIN+QP ++ GDGPI LVL E + Q+VA G H C++ Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTREL-AQQVQEVAYSVGKHCKLR-STCIYGGA 170 Query: 732 LKESKPGTLRRGXKIVI 782 K + L RG +I I Sbjct: 171 PKGPQIRELERGVEICI 187 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 59.7 bits (138), Expect = 3e-09 Identities = 36/110 (32%), Positives = 56/110 (50%), Gaps = 4/110 (3%) Frame = +1 Query: 256 VSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHE-VTVSGVEVHNPIQYFEEANFPDYVQQ 432 V QPF K+FY P + K +P E +E+R + E + V G P++ + + + Sbjct: 59 VVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILD 118 Query: 433 GVKTMGYKEPTPIQAQGWPIAMSGKI*LAY---PKRVPAKRWPTSCQPLC 573 +K Y++PTPIQAQ P+ MSG+ +A P R A + C+ C Sbjct: 119 VLKKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHRECKKFC 168 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 55.6 bits (128), Expect = 5e-08 Identities = 24/74 (32%), Positives = 41/74 (55%) Frame = +1 Query: 286 YDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 465 Y HPT+ + +V++ R+ E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 466 PIQAQGWPIAMSGK 507 PIQ Q P+ +SG+ Sbjct: 221 PIQMQVLPVLLSGR 234 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 49.6 bits (113), Expect = 3e-06 Identities = 23/57 (40%), Positives = 34/57 (59%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLGGLXES*HNKFQQVA 674 +D++G+ +TGSGKTLAY LP + + + P GD P+AL+L E F V+ Sbjct: 110 RDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQVFMNVS 166 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/79 (29%), Positives = 39/79 (49%) Frame = +1 Query: 271 FNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 450 F ++YD + V + S V+E R + + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 451 YKEPTPIQAQGWPIAMSGK 507 ++ PTPIQ Q MSG+ Sbjct: 92 FQVPTPIQMQSLSCVMSGR 110 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 49.2 bits (112), Expect = 4e-06 Identities = 20/57 (35%), Positives = 34/57 (59%) Frame = +1 Query: 337 YRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 +R + ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + + Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNR 139 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLGGLXE 644 +D++GV +TGSGKT A+ +P +V I P I R + GP AL+L E Sbjct: 139 RDIIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRE 189 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +1 Query: 325 EVEEYRNNHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 492 ++ +R+ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 493 AMSG 504 G Sbjct: 197 MAHG 200 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +1 Query: 352 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 749 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILPAIVHINN 584 +D++ +TGSGKT A++LP + + N Sbjct: 749 RDVMACAQTGSGKTAAFLLPVMTSMMN 775 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +1 Query: 352 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 172 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 361 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 VSG I F E F + + + GY+ PTP+Q PI M+G+ Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGR 517 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLGGLXE 644 +DL+ +TGSGKT AY+LP + + Q P+AL + E Sbjct: 517 RDLMACAQTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRE 563 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +3 Query: 438 KDNGLQRTDAHSSSRLADSYVWKDLVGVPKTGSGKTLAYILPAIVHINN-QPPIRRGDGP 614 KD G +A +DL+G KTGSGKTLA+++P + + Q R G G Sbjct: 588 KDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVVELLYKLQFKTRNGTGV 647 Query: 615 IAL 623 I + Sbjct: 648 III 650 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +3 Query: 441 DNGLQRTDAHSSSRLADSYVW-KDLVGVPKTGSGKTLAYILPAIVHI 578 D G + S + + ++ +D++G +TGSGKTLA+ +P I HI Sbjct: 147 DQGFSKPTPIQSLSIPPALLYHRDIIGAAETGSGKTLAFGIPIIQHI 193 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 35.9 bits (79), Expect = 0.045 Identities = 21/54 (38%), Positives = 31/54 (57%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLGGLXES*HNKFQ 665 +D++G KTGSGKTLA+++P I + Q DG ALV+ E + F+ Sbjct: 88 RDVLGAAKTGSGKTLAFLIPIIETLWRQKWTSM-DGLGALVISPTRELAYQTFE 140 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 ++ F + G+ G+ PT IQ QG P+A+SG+ Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGR 88 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = +3 Query: 438 KDNGLQRTDAHSSSRLADSYVWKDLVGVPKTGSGKTLAYILPAIVHI-NNQPPIRRGDGP 614 +D G+ +S Y +D++G +TG+GKTL++ LP + + + + +RG P Sbjct: 89 EDRGITYLFPIQASTFNYIYDGEDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAP 148 Query: 615 IALVLGGLXE 644 LV+ E Sbjct: 149 KVLVMAPTRE 158 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILPAIVHINNQPPIRR---GDGPIALVL 629 +D+ GV GSGK LAY+LP I I + +GP+ L+L Sbjct: 225 RDVAGVAIEGSGKRLAYLLPIIHQITESSVYQELPLANGPLVLIL 269 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILPAIVHINNQP 590 +D +G KTGSGKT A+ LP + + + P Sbjct: 45 RDCIGCAKTGSGKTAAFALPILQKLCDDP 73 >SB_51385| Best HMM Match : DEAD (HMM E-Value=0.00031) Length = 127 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +3 Query: 483 LADSYVWKDLVGVPKTGSGKTLAY-ILPAIVHINNQPPIRRGDGPIALVLGGL 638 L Y+ KD++ V TG GK+L + +LPA++H G+ P+ +++ L Sbjct: 10 LESLYLNKDVLAVLPTGYGKSLVFHLLPALLHKQRLLRNVSGNPPVVIIISPL 62 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILPAIVHINNQP 590 KD++G+ +TGSGKT A+ LP + + + P Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNP 30 >SB_34740| Best HMM Match : DEAD (HMM E-Value=0.00031) Length = 233 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +3 Query: 483 LADSYVWKDLVGVPKTGSGKTLAY-ILPAIVHINNQPPIRRGDGPIALVLGGL 638 L Y+ KD++ V TG GK+L + +LPA++H G+ P+ +++ L Sbjct: 116 LESLYLNKDVLAVLPTGYGKSLVFHLLPALLHKQRLLRNVSGNPPVVIIISPL 168 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 430 QGVKTMGYKEPTPIQAQGWPIAMSGK 507 + V +G+ PTPIQA P+A+ GK Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGK 48 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 373 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 486 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 I FE+ + + + V GYK+PTP+Q PI + GK Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPI-VKGK 912 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILPAIVHINNQPP 593 +DL+ +TGSGKT A+++P + I + P Sbjct: 913 RDLMACAQTGSGKTAAFLIPILSRIYMEGP 942 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILP 563 KD+V + +TGSGKT A+++P Sbjct: 319 KDVVAMARTGSGKTAAFLIP 338 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LAYPKRVPAK 543 FE+ + G+ G+ +P+PIQ + P+A++G+ LA K K Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LAYPKRVPAK 543 FE+ + G+ G+ +P+PIQ + P+A++G+ LA K K Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +1 Query: 283 FYDPHPTVLKRSPYEVEEYRNN--HEVTVSGVEVHNPIQYFEEANFPDY 423 + D VL E EE NN H++ + + +HNP YFE+ + DY Sbjct: 217 YRDEDDGVLVPIEQEAEEEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_51151| Best HMM Match : Vicilin_N (HMM E-Value=0.19) Length = 493 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = -2 Query: 176 YCHRCQIEKNYRRICCLL----QIWNHRFHGYYSSYQT*LFF 63 +CHR Q NY C ++ Q+W+H + SS ++ +F+ Sbjct: 178 FCHRQQYRHNYYNSCLVITFFRQMWDHLWANVGSSVESSVFY 219 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 349 HEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 501 HEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 86 HEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_41425| Best HMM Match : DCX (HMM E-Value=8.6e-06) Length = 1098 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/53 (35%), Positives = 24/53 (45%) Frame = +1 Query: 412 FPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LAYPKRVPAKRWPTSCQPL 570 +P+ + K G KE P AQ W I SG L Y K +P S +PL Sbjct: 684 YPEVSLEVKKKKGSKEVWPSDAQMWVITQSG---LIYSKAMPQLALTRSERPL 733 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 525 KTGSGKTLAYILPAIVHINNQPPIRRG 605 +TGSGKTLAY+ P +VH + R G Sbjct: 423 QTGSGKTLAYLAP-LVHRLREDEERHG 448 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,874,607 Number of Sequences: 59808 Number of extensions: 615604 Number of successful extensions: 3453 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 3324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3451 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2597949818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -