BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0215.Seq (900 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43575| Best HMM Match : Sina (HMM E-Value=0) 38 0.015 SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 5.1 SB_35860| Best HMM Match : Sugar_tr (HMM E-Value=1e-04) 29 6.8 SB_6416| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 >SB_43575| Best HMM Match : Sina (HMM E-Value=0) Length = 432 Score = 37.5 bits (83), Expect = 0.015 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 160 DLDNLLQCPVCYEIPTGHIFQCNEGHNVC 246 DL ++ +CPVC++ I QC+ GH VC Sbjct: 30 DLTSIFECPVCFDYVLPPILQCSSGHLVC 58 >SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4277 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -2 Query: 824 MPRYGNCVTKTICYPGDAAN-RNQAYK 747 +P+ NC+ K ICY + AN RN+ +K Sbjct: 515 LPKNDNCIIKGICYAKNEANPRNRRHK 541 >SB_35860| Best HMM Match : Sugar_tr (HMM E-Value=1e-04) Length = 544 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 303 FQKIVPCIPGRQKAELSSATYIMTFIALE-NMTCRDFITYWTL 178 FQ ++ C+ G ++ T IMTF+ALE CR+ T L Sbjct: 4 FQWMIVCVVGLMMVPVTFQTLIMTFLALEPAWKCRNGSTICNL 46 >SB_6416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 303 FQKIVPCIPGRQKAELSSATYIMTFIALE-NMTCRDFITYWTL 178 FQ ++ C+ G ++ T IMTF+ALE CR+ T L Sbjct: 4 FQWMIVCVVGLMMVPVTFQTLIMTFLALEPAWKCRNGSTICNL 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,169,850 Number of Sequences: 59808 Number of extensions: 597434 Number of successful extensions: 1941 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1889 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -