BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0214.Seq (886 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43575| Best HMM Match : Sina (HMM E-Value=0) 38 0.011 SB_20641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_46135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_32104| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_30862| Best HMM Match : MAM (HMM E-Value=0.00035) 28 8.7 >SB_43575| Best HMM Match : Sina (HMM E-Value=0) Length = 432 Score = 37.9 bits (84), Expect = 0.011 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 161 DLDNLLQCPVCYEIPTGHIFQCNEGHNVCGRLK 259 DL ++ +CPVC++ I QC+ GH VC + Sbjct: 30 DLTSIFECPVCFDYVLPPILQCSSGHLVCSNCR 62 >SB_20641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 36.3 bits (80), Expect = 0.033 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 5/84 (5%) Frame = +1 Query: 424 DSGSDNAEYLGEDENNDNQNSVV--APNPCKDFFV---ASGCKNGNSIRLPGSSFT*PPS 588 DS DN+ +G ++N+DNQ + + +P K +++ A+G G S RL T P Sbjct: 124 DSDDDNSVSVGNNDNDDNQRICISHSSSPGKGWYIYIEATGKTQGTSARLLSPLMTGPKC 183 Query: 589 LTFILPELLEGRAEXVEYLQSMGR 660 +TF E + + Y+ GR Sbjct: 184 MTFFSHLYGEDMSLVLVYVTVSGR 207 >SB_46135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = +3 Query: 645 SKHG-QISTNSWG-NLVTGNQKFSNMGIIFSXPLKY 746 SKH ++ + W NLVTG ++ +N ++ P+KY Sbjct: 100 SKHSLEVKVSVWAENLVTGQRRLANRAALWYVPVKY 135 >SB_32104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 29.5 bits (63), Expect = 3.8 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 5/94 (5%) Frame = +1 Query: 394 ASDSSSTPARDSGSDNAEYLGEDENNDNQNSVV--APNPCKDFFVASGCK---NGNSIRL 558 + D DS DN+ + ++N+DNQ + + +P K +++ S G RL Sbjct: 79 SGDGGVVFGEDSDDDNSVSVCNNDNDDNQRICISHSSSPGKGWYIYSEASLYWKGYYARL 138 Query: 559 PGSSFT*PPSLTFILPELLEGRAEXVEYLQSMGR 660 T P +TF EG + + Y+ GR Sbjct: 139 HSPLMTGPKCMTFFSNLNGEGMSLVLVYVTVSGR 172 >SB_30862| Best HMM Match : MAM (HMM E-Value=0.00035) Length = 330 Score = 28.3 bits (60), Expect = 8.7 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 5/63 (7%) Frame = +1 Query: 424 DSGSDNAEYLGEDENNDNQNSVVAPNPC--KDFFV---ASGCKNGNSIRLPGSSFT*PPS 588 DS DN+ +G D+N+DNQ ++ + K +++ AS S RL + T P Sbjct: 79 DSDDDNSVSVGNDDNDDNQIIRISHSSSTGKGWYIYLKASLRSKRESARLHSTLMTGPKC 138 Query: 589 LTF 597 +TF Sbjct: 139 MTF 141 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,535,597 Number of Sequences: 59808 Number of extensions: 514371 Number of successful extensions: 1682 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1623 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2526446612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -