BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0212.Seq (526 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15577| Best HMM Match : Ribosomal_L28e (HMM E-Value=0.00022) 49 2e-06 SB_5153| Best HMM Match : zf-AD (HMM E-Value=2.2) 40 0.001 SB_10504| Best HMM Match : MBOAT (HMM E-Value=0.16) 30 1.3 SB_25068| Best HMM Match : PI-PLC-X (HMM E-Value=0) 29 3.1 SB_650| Best HMM Match : rve (HMM E-Value=0.00048) 28 4.1 SB_40091| Best HMM Match : CNH (HMM E-Value=8.5e-07) 27 7.2 SB_184| Best HMM Match : PAN (HMM E-Value=4.1e-09) 27 7.2 SB_54034| Best HMM Match : Tctex-1 (HMM E-Value=7.5) 27 9.5 SB_46683| Best HMM Match : F5_F8_type_C (HMM E-Value=9.6e-12) 27 9.5 SB_11192| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_15577| Best HMM Match : Ribosomal_L28e (HMM E-Value=0.00022) Length = 90 Score = 49.2 bits (112), Expect = 2e-06 Identities = 25/69 (36%), Positives = 40/69 (57%) Frame = +2 Query: 221 P*QEGIHSSVQEAKATRKPAKNLIRRPFKAGARRSLYKVKRLLKANHYRTDLCKATLRRA 400 P +G+ + ++ KA KP K + + +RR+L ++ + N+YR DL +RRA Sbjct: 8 PSGKGVVITTRKNKAANKPGKIMNKITISRDSRRTLKTIEGVCDKNYYRMDLKDPAMRRA 67 Query: 401 SAILRSQRP 427 AILRSQ+P Sbjct: 68 CAILRSQKP 76 >SB_5153| Best HMM Match : zf-AD (HMM E-Value=2.2) Length = 132 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/59 (35%), Positives = 33/59 (55%) Frame = +2 Query: 47 RKNVVVTELDDHPQQQCIPCEEAQYQKAVQQGAEQCD*PPLLQVQRLDSQESCWCRGEP 223 R NV D +P+ C PCE + Y+ +Q+G EQ PP+L+ ++E C+C +P Sbjct: 55 RVNVTEENEDVYPELLCRPCEGSLYR--LQKGKEQ---PPILRSWTPHTEEGCFCEAKP 108 >SB_10504| Best HMM Match : MBOAT (HMM E-Value=0.16) Length = 465 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -2 Query: 318 LAPALNGRRIKFLAGFLVAFASCTLL 241 L PA NG R +F G+L+A +SC +L Sbjct: 398 LVPAFNGFRWRFYIGWLLAESSCIML 423 >SB_25068| Best HMM Match : PI-PLC-X (HMM E-Value=0) Length = 219 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 475 KLFRLGCGCLSLFCFNGPLG 416 + R+GC CL L C++GP G Sbjct: 91 RCLRMGCRCLELDCWDGPDG 110 >SB_650| Best HMM Match : rve (HMM E-Value=0.00048) Length = 363 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +2 Query: 17 VVFGVEIGLNRKNVVVTELDDH--PQQQCIPCEEAQYQKAVQ 136 V G+E N +N+ +T + P Q +PC +A Y+ VQ Sbjct: 239 VTIGMEKFTNPRNIQLTSTTTYVPPNQVYVPCSQALYKPEVQ 280 >SB_40091| Best HMM Match : CNH (HMM E-Value=8.5e-07) Length = 653 Score = 27.5 bits (58), Expect = 7.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 2 THCEHVVFGVEIGLNRKNVVVTELDDHPQQQCI 100 +HC+H++ G E G+ N + + D +QC+ Sbjct: 261 SHCKHILIGAEEGIYSLN-ISDHVHDMEMEQCL 292 >SB_184| Best HMM Match : PAN (HMM E-Value=4.1e-09) Length = 720 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 265 YQKAR*KLNPPSIQGWCQEVTV 330 YQK LNP S GWC+ V V Sbjct: 451 YQKDPCVLNPCSSHGWCEAVNV 472 >SB_54034| Best HMM Match : Tctex-1 (HMM E-Value=7.5) Length = 255 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +3 Query: 78 IIRNNNAFLVKKRNIKKPFSKEPNNVT-NLHSFRYNGLIHKKAVGVVENPDRKGFT 242 ++ + + FL K PF+ + +V LH +G ++ AV VE R+GFT Sbjct: 9 LVSSPSDFLCKTIPFSTPFATDSVHVQITLHMDEQSGPTYEAAVNWVEQVCREGFT 64 >SB_46683| Best HMM Match : F5_F8_type_C (HMM E-Value=9.6e-12) Length = 495 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/58 (25%), Positives = 30/58 (51%) Frame = +2 Query: 167 LLQVQRLDSQESCWCRGEP*QEGIHSSVQEAKATRKPAKNLIRRPFKAGARRSLYKVK 340 +L+VQRL +QE C ++ I V++ + RK + L + + + R L +++ Sbjct: 52 MLEVQRLSAQEKCHQGENLLKDRIQELVEDLEGERKTKQELSAQLIEERSLRELKQIE 109 >SB_11192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -3 Query: 194 VNQAVVPEGVEVSHIVRLLAERL--FDIALLHKECIVVADDHPV 69 VN+ V ++ +++L RL D++L++K CI A DH V Sbjct: 138 VNEVVKKSSKKLYFLIQLKRARLPPSDLSLIYKACIRSAVDHAV 181 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,494,995 Number of Sequences: 59808 Number of extensions: 316427 Number of successful extensions: 829 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 828 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1184975377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -