BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0207.Seq (668 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.052 SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_40635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_44560| Best HMM Match : DUF1086 (HMM E-Value=1.2) 30 1.5 SB_54812| Best HMM Match : 7tm_1 (HMM E-Value=0) 30 2.0 SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) 29 3.4 SB_27873| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_48652| Best HMM Match : RVT_1 (HMM E-Value=0.0009) 29 4.5 SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_32453| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_8531| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 7.9 SB_10754| Best HMM Match : C2 (HMM E-Value=5.1e-40) 28 7.9 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 421 DVVAVSQAPSPESNPDSPLPVTTM 492 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 430 AVSQAPSPESNPDSPLPVTTM 492 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +2 Query: 431 PFLRLPLRNRTLIPRYP 481 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 255 IPAPIAYTKIVAVKKL 208 IPAPIAY K+VAVKKL Sbjct: 38 IPAPIAYIKVVAVKKL 53 >SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 255 IPAPIAYTKIVAVKKL 208 IPAPIAY K+VAVKKL Sbjct: 83 IPAPIAYIKVVAVKKL 98 >SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 255 IPAPIAYTKIVAVKKL 208 IPAPIAY K+VAVKKL Sbjct: 11 IPAPIAYIKVVAVKKL 26 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 255 IPAPIAYTKIVAVKKL 208 IPAPIAY K+VAVKKL Sbjct: 75 IPAPIAYIKVVAVKKL 90 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 347 TLTRPRNRNEYTLNILTRNNWRASLVPAAAV 255 T + R ++++ R +WRASLVPAAAV Sbjct: 44 TCQQTTTRVHAAMHLVIRIHWRASLVPAAAV 74 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 255 IPAPIAYTKIVAVKKL 208 IPAPIAY K+VAVKKL Sbjct: 28 IPAPIAYIKVVAVKKL 43 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 255 IPAPIAYTKIVAVKKL 208 IPAPIAY K+VAVKKL Sbjct: 15 IPAPIAYIKVVAVKKL 30 >SB_40635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -3 Query: 288 LEGKSGASSRGIPAPIAYTKIVAVKKL 208 +EGKSGASSRG + + K+ + KKL Sbjct: 1 MEGKSGASSRGYSSSNSVYKVCSFKKL 27 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 630 IDGRASRPKSLILMNLDNFCRSHGQVPATHLSNVCLINFRCS 505 I+ R SR +S + +D+ SH TH S CL N RC+ Sbjct: 13 INNRTSRCESANRVLVDHVIASHNVTNPTHCSMNCLSNERCA 54 >SB_44560| Best HMM Match : DUF1086 (HMM E-Value=1.2) Length = 918 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 214 FNRNNFSIRYWS-WNTAAAGTRLALQLFLVKIFKVYSFRLRGL 339 + F+I W +T G+R L+ F++ +KVY RL GL Sbjct: 714 YTLGRFTIHDWKVHDTHLEGSRYTLERFMIHPWKVYDTRLEGL 756 >SB_54812| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 392 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Frame = +1 Query: 61 RHSPKSTATRILILNRRFLERR---LTDDMLRKRVSITADACTDSAAHKCNYELFNRNNF 231 RH+ T L R+L+R + +D L K+ D DS C++ FNR++ Sbjct: 328 RHTLSQTTFHESELPNRYLQRMHKSVLNDRLAKKTGKRPDTEVDSKRSNCSHATFNRDSL 387 Query: 232 SI 237 I Sbjct: 388 KI 389 >SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) Length = 1392 Score = 29.1 bits (62), Expect = 3.4 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = +1 Query: 37 QSKIVGPPRHSPKSTATRI--LILNRRFLER--RLTDDMLRKRVSITADACTDSAAHKCN 204 +S+ VG P S KST R+ L+ R LER L + L KR TA +S ++ Sbjct: 1109 ESRDVGKPESSSKSTGDRVAGLVSEARVLERFSVLQAETLYKRACDTA-LSAESPDNRAT 1167 Query: 205 YELF 216 Y+ F Sbjct: 1168 YKAF 1171 >SB_27873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 550 GDASFKCLPYQLSM 509 GD SFK LPYQLSM Sbjct: 91 GDVSFKFLPYQLSM 104 >SB_48652| Best HMM Match : RVT_1 (HMM E-Value=0.0009) Length = 938 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 575 FADRMVKYRRRIFQMSALSTFDVVSATTMVVTGNG 471 FAD + K + ++SA S+ VV+ TT TG G Sbjct: 221 FADEISKANKVATKISASSSVSVVTVTTTTTTGRG 255 >SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 550 GDASFKCLPYQLSM 509 GD SFK LPYQLSM Sbjct: 685 GDVSFKFLPYQLSM 698 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 550 GDASFKCLPYQLSM 509 GD SFK LPYQLSM Sbjct: 65 GDVSFKFLPYQLSM 78 >SB_32453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 281 PSN--CSSLKYLKCTHSDYEAS*ESRIVIFRHYL 376 PSN CS L YL+C +R+++F H L Sbjct: 523 PSNLRCSILSYLRCNKPPVTIRWRTRLIVFTHLL 556 >SB_8531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = +1 Query: 436 SQAPSPESNPDSPLPVTTMVVAETTSKVDKADI*KMRRRYLTMRSAKVIQIHQ 594 ++ P+P+ P P +M+ E + ++ + RRR T+R+ K I +Q Sbjct: 34 TRVPAPKQRPRMP-NTESMICKENSDHINLSKAQSQRRRKATLRALKPIHCNQ 85 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 412 PSLDVVAVSQAPSPESNPDSPLP 480 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 >SB_10754| Best HMM Match : C2 (HMM E-Value=5.1e-40) Length = 2057 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/51 (23%), Positives = 24/51 (47%) Frame = +2 Query: 515 KLIRQTFERCVAGT*PCDLQKLSRFIKINDFGREALPSIGFDLIKALIPSL 667 K+ + E C+A D+ K +++ G ++ G DL+ ++P L Sbjct: 1557 KIPSENMECCLATDNDLDVTKWIELLQLESCGYDSTEQSGLDLLNGIVPQL 1607 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,002,801 Number of Sequences: 59808 Number of extensions: 447701 Number of successful extensions: 1186 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1186 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -