BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0137.Seq (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30416| Best HMM Match : Prosystemin (HMM E-Value=2.2) 29 3.2 SB_9388| Best HMM Match : SRP54_N (HMM E-Value=4.8) 29 4.2 SB_25813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) 28 5.6 SB_9683| Best HMM Match : RCSD (HMM E-Value=2.8) 28 5.6 SB_38465| Best HMM Match : Nitrophorin (HMM E-Value=0.75) 28 5.6 SB_2366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_59625| Best HMM Match : P19Arf_N (HMM E-Value=5.1) 28 7.4 SB_54597| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 28 7.4 SB_35638| Best HMM Match : Upf2 (HMM E-Value=2.1e-17) 28 7.4 SB_31234| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_8912| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_5351| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_2690| Best HMM Match : Pre-SET (HMM E-Value=0.11) 28 7.4 SB_59350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_16949| Best HMM Match : DUF1174 (HMM E-Value=0.08) 28 7.4 SB_19130| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_3322| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_30681| Best HMM Match : An_peroxidase (HMM E-Value=4.3e-29) 27 9.8 >SB_30416| Best HMM Match : Prosystemin (HMM E-Value=2.2) Length = 455 Score = 29.1 bits (62), Expect = 3.2 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 7/98 (7%) Frame = +3 Query: 294 RKRRLVSSQINATISATTSARPIPLT--DSPFSHS-----HGCQQSKTTCAKSNRK*STR 452 RK ++ ++ S +A+P PLT DSPF S HG +++T+ + + T Sbjct: 169 RKEPKKAAVVSTPPSRAPAAKP-PLTRHDSPFVKSITESGHGKSRTETSSITISPRHPTN 227 Query: 453 QVRGNVARRPLKKNASTAGCQESAPARNYRDRDKTDLA 566 RG+V+ +N+ST E++P RN R +L+ Sbjct: 228 SPRGSVSEAASPRNSST----ETSP-RNSRTEMNINLS 260 >SB_9388| Best HMM Match : SRP54_N (HMM E-Value=4.8) Length = 286 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 371 GFTVQPQPRVPAK*NHLRQKQQKIEYTPGARKRSPPTAQKKR 496 G V P + A+ N LR KQ++I+Y P QK+R Sbjct: 238 GSIVCKNPELVARLNKLRAKQEQIQYDQMVANVGPALEQKQR 279 >SB_25813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = +1 Query: 376 HRSATATGASKVKPPAPKATENRVHARCEET*PADRSKKTPAPPDARNQPQPE 534 H A ++ +P A K E H E+ A++ + P+A QP+ E Sbjct: 49 HPEAEKQPEAEKQPEAEKHPEAEKHPEAEKQPEAEKQPEAEKQPEAEKQPEAE 101 >SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) Length = 1667 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 88 LVDDPNQFHGLAADQLTDDIVEQPVSINGIA-HNIKRSDFMSLPL 219 +VDD +F G LTD VE S++G+A H + S PL Sbjct: 1559 MVDDGTEFKGATTKLLTDYGVETSWSLDGLALHPVDGSPARVFPL 1603 >SB_9683| Best HMM Match : RCSD (HMM E-Value=2.8) Length = 232 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +3 Query: 270 SFTS*KQARKRRLVSSQINATISATTSARPIPLTDSPFSHSHGCQQSKTTCAKSN 434 SFTS ++ R V+ ++ A + P P+T SP SHSH + KT+ + N Sbjct: 77 SFTS--KSETRESVTHSMSR-FPAYRTVNPTPVTQSPTSHSH--ESIKTSSSTKN 126 >SB_38465| Best HMM Match : Nitrophorin (HMM E-Value=0.75) Length = 1167 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 240 GVQIHKKCRYSFTS*KQARKRRLVSSQINATISATTSARP 359 G ++H KCR +T A K V N T++A S RP Sbjct: 43 GQRVHVKCRLHYTRRPAANKS--VDENKNPTVAARRSGRP 80 >SB_2366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 240 GVQIHKKCRYSFTS*KQARKRRLVSSQINATISATTSARPI 362 G ++H KCR +T A K V N T++A S PI Sbjct: 43 GQRVHVKCRLDYTRRPAANKS--VDENKNPTVAARRSGNPI 81 >SB_59625| Best HMM Match : P19Arf_N (HMM E-Value=5.1) Length = 1463 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 240 GVQIHKKCRYSFTS*KQARKRRLVSSQINATISATTSARPI 362 G ++H KCR +T A K V N T++A S PI Sbjct: 1263 GQRVHVKCRLDYTRRPAANKS--VDENKNPTVAARRSGSPI 1301 >SB_54597| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 755 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -2 Query: 161 TGCSTMSSVNWSAANPWNWFGSSTKVSEQGVGELTAST 48 TGC + + + +PW FG + + GE T ST Sbjct: 399 TGCGPVFGGDSAFGDPWFGFGCDLLIDDNAGGEKTCST 436 >SB_35638| Best HMM Match : Upf2 (HMM E-Value=2.1e-17) Length = 1420 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -3 Query: 400 HPWLWLNGESVSGIGLALVVADIVALIWLLTNRRLR 293 + WLW G ++ + AL ++ +W NR LR Sbjct: 417 YSWLWTIGLLLTALPTALTNIAVIVAVWKDPNRNLR 452 >SB_31234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 286 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 240 GVQIHKKCRYSFTS*KQARKRRLVSSQINATISATTSARPI 362 G ++H KCR +T A K V N T++A S PI Sbjct: 43 GQRVHVKCRLDYTRRPAANKS--VDENKNPTVAARRSGSPI 81 >SB_8912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 240 GVQIHKKCRYSFTS*KQARKRRLVSSQINATISATTSARPI 362 G ++H KCR +T A K V N T++A S PI Sbjct: 43 GQRVHVKCRLDYTRRPAANKS--VDENKNPTVAARRSGSPI 81 >SB_5351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 419 LRQKQQKIEYTPGARKRSPPTAQKKRQHRRMP 514 LR KQ+ +YT +R SPP Q R P Sbjct: 533 LRAKQEAADYTDASRIASPPIPTLANQRRHGP 564 >SB_2690| Best HMM Match : Pre-SET (HMM E-Value=0.11) Length = 715 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 240 GVQIHKKCRYSFTS*KQARKRRLVSSQINATISATTSARPI 362 G ++H KCR +T A K V N T++A S PI Sbjct: 43 GQRVHVKCRLDYTRRPAANKS--VDENKNPTVAARRSGSPI 81 >SB_59350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 240 GVQIHKKCRYSFTS*KQARKRRLVSSQINATISATTSARPI 362 G ++H KCR +T A K V N T++A S PI Sbjct: 43 GQRVHVKCRLDYTRRPAANKS--VDENKNPTVAARRSGSPI 81 >SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1332 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +2 Query: 332 NIRHYQRQTDTANGFTVQPQPRVPAK*N-HLRQKQQKIEYTPGARKRSPPTAQKKRQHRR 508 N H+Q Q N ++ + A + H K + + P A +P ++KKR+ RR Sbjct: 433 NSEHFQNQQVNINNLVIKYDNTLKALLDKHAPLKAKLVTIRPKAAWYTPEVSEKKRKRRR 492 Query: 509 M 511 + Sbjct: 493 L 493 >SB_16949| Best HMM Match : DUF1174 (HMM E-Value=0.08) Length = 349 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +3 Query: 303 RLVSSQINATISATTSARPIPLTDSP 380 RL +S I ATI SA PIP T +P Sbjct: 292 RLSASPIPATIGPPLSASPIPATTAP 317 >SB_19130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 658 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +2 Query: 344 YQRQTDTANGFTVQPQPRVPAK*NHLRQKQQKIEYTPGARKRSPPTAQKKRQ 499 + T NG P+P PA+ +H R Q +Y G K P +K RQ Sbjct: 338 WNNSTKVDNG-QATPRPERPARTSHSRTTSQPSQYC-GKMKYDDPLFEKVRQ 387 >SB_3322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 777 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 348 SARPIPLTDSPFSHSHGCQQSKTTCAKSN-RK*STRQVR 461 S +P+P P+ HG + +KT C+ N RK S R VR Sbjct: 64 SPKPVPF---PYPSPHGNEPTKTLCSLVNLRKDSLRLVR 99 >SB_30681| Best HMM Match : An_peroxidase (HMM E-Value=4.3e-29) Length = 576 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 528 ARNYRDRDKTDLAAQYPARAKHRQ*QTAPRFAP 626 A+ D DKT++A Q P H + P++ P Sbjct: 41 AKREIDEDKTEIAGQQPLARHHHYNRVVPKWEP 73 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,142,102 Number of Sequences: 59808 Number of extensions: 461960 Number of successful extensions: 1651 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1645 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -