BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301G07f (429 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 52 2e-07 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 52 3e-07 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 51 4e-07 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 8e-07 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 8e-07 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 50 1e-06 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 50 1e-06 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-06 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-06 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 49 1e-06 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 49 1e-06 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 49 1e-06 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 49 1e-06 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-06 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-06 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-06 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 49 1e-06 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 49 1e-06 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-06 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-06 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-06 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 49 2e-06 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 49 2e-06 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 49 2e-06 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 49 2e-06 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 48 2e-06 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 48 2e-06 SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 48 3e-06 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 48 3e-06 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 48 3e-06 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 48 3e-06 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 48 3e-06 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 48 3e-06 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 48 3e-06 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 48 3e-06 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 48 3e-06 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 48 3e-06 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 48 3e-06 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 48 3e-06 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 48 3e-06 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 48 3e-06 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 48 3e-06 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 48 3e-06 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 48 4e-06 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 48 4e-06 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 48 4e-06 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 47 6e-06 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 47 6e-06 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 47 6e-06 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 47 6e-06 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 47 6e-06 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 47 6e-06 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 47 6e-06 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 47 6e-06 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 47 6e-06 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 47 6e-06 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 47 6e-06 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 47 6e-06 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 47 6e-06 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 47 6e-06 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 47 6e-06 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 47 6e-06 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 47 6e-06 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 47 6e-06 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 47 6e-06 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 47 6e-06 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 47 6e-06 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 47 6e-06 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 47 6e-06 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 47 6e-06 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 47 6e-06 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 47 6e-06 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 47 6e-06 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 47 6e-06 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 47 6e-06 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 47 6e-06 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 47 6e-06 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 47 6e-06 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 47 6e-06 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 47 6e-06 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 47 6e-06 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 47 6e-06 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 47 6e-06 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 47 6e-06 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 47 6e-06 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 6e-06 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 8e-06 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 47 8e-06 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 8e-06 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 8e-06 SB_9479| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 8e-06 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 8e-06 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 46 1e-05 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 46 1e-05 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 46 1e-05 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 46 1e-05 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 46 1e-05 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 46 1e-05 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 46 1e-05 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 46 1e-05 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 46 1e-05 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 46 1e-05 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 46 1e-05 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 46 1e-05 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 46 1e-05 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 46 1e-05 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 46 1e-05 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 46 1e-05 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 46 1e-05 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 46 1e-05 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 46 1e-05 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 46 1e-05 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 46 1e-05 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 46 1e-05 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 46 1e-05 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 46 1e-05 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 46 1e-05 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 46 1e-05 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 46 1e-05 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 46 1e-05 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 46 1e-05 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 52.4 bits (120), Expect = 2e-07 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGP 316 LSWVTPGFSQSRRCKTTAS + L + G PGP Sbjct: 128 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPGP 162 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 51.6 bits (118), Expect = 3e-07 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPP 313 LSWVTPGFSQSRRCKTTAS + L + G P PP Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFPP 87 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 51.2 bits (117), Expect = 4e-07 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = +2 Query: 311 EGGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 +GG G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 51 QGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQL 86 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 50.0 bits (114), Expect = 8e-07 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPPSS 307 LSWVTPGFSQSRRCKTTAS + L + G P P+S Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPLSPAS 67 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 50.0 bits (114), Expect = 8e-07 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +2 Query: 314 GGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 GG G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 44 GGIGDPLESTCRHASLALAVVLQRRDWENPGVTQL 78 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS + L + G PG Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS + L + G PG Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 85 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS + L + G PG Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS + L + G PG Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS + L + G PG Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 85 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS + L + G PG Sbjct: 44 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 77 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 49.6 bits (113), Expect = 1e-06 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPPSS 307 LSWVTPGFSQSRRCKTTAS + L + G P P S Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFTPPS 89 >SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS + L + G PG Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS + L + G PG Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 49.6 bits (113), Expect = 1e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 426 GDLSWVTPGFSQSRRCKTTASEI 358 G LSWVTPGFSQSRRCKTTASE+ Sbjct: 28 GRLSWVTPGFSQSRRCKTTASEL 50 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS + L + G PG Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 85 >SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS + L + G PG Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS + L + G PG Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 320 PGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 PG P+ +++LAVVLQRRDWENPGVTQL Sbjct: 1 PGDPLESTCRHASLALAVVLQRRDWENPGVTQL 33 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 49.2 bits (112), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 320 PGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 PG P+ +++LAVVLQRRDWENPGVTQL Sbjct: 61 PGDPLESTCRHASLALAVVLQRRDWENPGVTQL 93 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 49.2 bits (112), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 320 PGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 PG P+ +++LAVVLQRRDWENPGVTQL Sbjct: 101 PGDPLESTCRHASLALAVVLQRRDWENPGVTQL 133 >SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) Length = 135 Score = 49.2 bits (112), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 320 PGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 PG P+ +++LAVVLQRRDWENPGVTQL Sbjct: 90 PGDPLESTCRHASLALAVVLQRRDWENPGVTQL 122 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 49.2 bits (112), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 320 PGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 PG P+ +++LAVVLQRRDWENPGVTQL Sbjct: 64 PGDPLESTCRHASLALAVVLQRRDWENPGVTQL 96 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 49.2 bits (112), Expect = 1e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGP 316 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 1134 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPKP 1168 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 49.2 bits (112), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 320 PGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 PG P+ +++LAVVLQRRDWENPGVTQL Sbjct: 29 PGDPLESTCRHASLALAVVLQRRDWENPGVTQL 61 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 49.2 bits (112), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 320 PGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 PG P+ +++LAVVLQRRDWENPGVTQL Sbjct: 19 PGDPLESTCRHASLALAVVLQRRDWENPGVTQL 51 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.2 bits (112), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 320 PGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 PG P+ +++LAVVLQRRDWENPGVTQL Sbjct: 43 PGDPLESTCRHASLALAVVLQRRDWENPGVTQL 75 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 49.2 bits (112), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 320 PGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 PG P+ +++LAVVLQRRDWENPGVTQL Sbjct: 78 PGDPLESTCRHASLALAVVLQRRDWENPGVTQL 110 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 49.2 bits (112), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 320 PGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 PG P+ +++LAVVLQRRDWENPGVTQL Sbjct: 66 PGDPLESTCRHASLALAVVLQRRDWENPGVTQL 98 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 49.2 bits (112), Expect = 1e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPP 313 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 23 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPAVP 58 >SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 49.2 bits (112), Expect = 1e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGP 316 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPPP 64 >SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 49.2 bits (112), Expect = 1e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGP 316 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 11 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPPP 45 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 48.8 bits (111), Expect = 2e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGP 316 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPMP 64 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 48.8 bits (111), Expect = 2e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGP 316 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPCP 86 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 48.8 bits (111), Expect = 2e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGP 316 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFP 86 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 48.8 bits (111), Expect = 2e-06 Identities = 25/59 (42%), Positives = 31/59 (52%) Frame = +2 Query: 242 SADQINGFCCYLIXXXXXXXXXLEGGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 S D CC + + G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 54 STDISERICCTTLLQGYPNPR-INGEDGDPLESTCRHASLALAVVLQRRDWENPGVTQL 111 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 48.8 bits (111), Expect = 2e-06 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = +2 Query: 308 LEGGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 L G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 23 LPGDNGDPLESTCRHASLALAVVLQRRDWENPGVTQL 59 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 48.8 bits (111), Expect = 2e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGP 316 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPYP 64 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 48.8 bits (111), Expect = 2e-06 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPPSS 307 LSWVTPGFSQSRRCKTTAS + L + G P P++ Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPVVPAA 89 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 48.8 bits (111), Expect = 2e-06 Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP-GPPSSXXXXXXXFLIR*QQNP 259 LSWVTPGFSQSRRCKTTAS + L + G P GP + R +Q P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPQGPRQRLRVRLRYRICRERQYP 84 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 48.8 bits (111), Expect = 2e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPP 313 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPRKP 87 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 48.4 bits (110), Expect = 2e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGP 316 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPIP 86 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 48.4 bits (110), Expect = 2e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +2 Query: 317 GPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 1174 GKGDPLESTCRHASLALAVVLQRRDWENPGVTQL 1207 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 48.4 bits (110), Expect = 2e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +2 Query: 317 GPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 44 GEGDPLESTCRHASLALAVVLQRRDWENPGVTQL 77 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 48.4 bits (110), Expect = 2e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPP 313 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPVAP 87 >SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.4 bits (110), Expect = 2e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPP 313 LSWVTP FSQSRRCKTTAS + L + G P PP Sbjct: 30 LSWVTPVFSQSRRCKTTASAKLACLQVDSRGSPHPP 65 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 48.4 bits (110), Expect = 2e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPP 313 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPKHP 87 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 37 LSWVTPGFSQSRRCKTTASEL 57 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.0 bits (109), Expect = 3e-06 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 266 CCYLIXXXXXXXXXLEGGP---GYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 CC + L P G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 13 CCVITHTLIPTWRALNDAPYPVGDPLESTCRHASLALAVVLQRRDWENPGVTQL 66 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 249 LSWVTPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 917 LSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 30 LSWVTPGFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 29 LSWVTPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 404 LSWVTPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 253 LSWVTPGFSQSRRCKTTASEL 273 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 48.0 bits (109), Expect = 3e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +2 Query: 317 GPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 68 GRGDPLESTCRHASLALAVVLQRRDWENPGVTQL 101 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 320 LSWVTPGFSQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 386 LSWVTPGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 78 LSWVTPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 37 LSWVTPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 30 LSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 30 LSWVTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 37 LSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 37 LSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 60 LSWVTPGFSQSRRCKTTASEL 80 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 48.0 bits (109), Expect = 3e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +2 Query: 317 GPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQL 121 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 296 LSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 280 LSWVTPGFSQSRRCKTTASEL 300 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.0 bits (109), Expect = 3e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +2 Query: 314 GGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENPGVTQL 72 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 48.0 bits (109), Expect = 3e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +2 Query: 317 GPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 49 GRGDPLESTCRHASLALAVVLQRRDWENPGVTQL 82 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 30 LSWVTPGFSQSRRCKTTASEL 50 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 48.0 bits (109), Expect = 3e-06 Identities = 22/26 (84%), Positives = 24/26 (92%), Gaps = 1/26 (3%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI-VIRL 346 LSWVTPGFSQSRRCKTTASE +I+L Sbjct: 559 LSWVTPGFSQSRRCKTTASEFDIIKL 584 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 269 LSWVTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 294 LSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 478 LSWVTPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 147 LSWVTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 313 LSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 163 LSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 37 LSWVTPGFSQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 356 LSWVTPGFSQSRRCKTTASEL 376 >SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 48.0 bits (109), Expect = 3e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPP 313 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 141 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFRP 176 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 48.0 bits (109), Expect = 3e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +2 Query: 317 GPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 703 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQL 736 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 30 LSWVTPGFSQSRRCKTTASEL 50 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 37 LSWVTPGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 23 LSWVTPGFSQSRRCKTTASEL 43 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 48.0 bits (109), Expect = 3e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPP 313 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPKYP 87 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 222 LSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 614 LSWVTPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 250 LSWVTPGFSQSRRCKTTASEL 270 >SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 48.0 bits (109), Expect = 3e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPP 313 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPWCP 65 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 48.0 bits (109), Expect = 3e-06 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = +2 Query: 311 EGGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 +G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 3 KGEEGDPLESTCRHASLALAVVLQRRDWENPGVTQL 38 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 48.0 bits (109), Expect = 3e-06 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPPS 310 LSWVTPGFSQSRRCKTTAS + L + G P S Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPADDS 88 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 90 LSWVTPGFSQSRRCKTTASEL 110 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 528 LSWVTPGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 111 LSWVTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 419 LSWVTPGFSQSRRCKTTASEL 439 >SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 48.0 bits (109), Expect = 3e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPGPP 313 LSWVTPGFSQSRRCKTTAS + L + G P P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFVP 65 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 23 LSWVTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEI 358 LSWVTPGFSQSRRCKTTASE+ Sbjct: 212 LSWVTPGFSQSRRCKTTASEL 232 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 48.0 bits (109), Expect = 3e-06 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = +2 Query: 311 EGGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 +G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 18 KGTKGDPLESTCRHASLALAVVLQRRDWENPGVTQL 53 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 47.6 bits (108), Expect = 4e-06 Identities = 21/37 (56%), Positives = 26/37 (70%) Frame = +2 Query: 308 LEGGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 + G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 15 VSGVTGDPLESTCRHASLALAVVLQRRDWENPGVTQL 51 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 47.6 bits (108), Expect = 4e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +3 Query: 354 LQFHWPSFYNVVTGKTLALPNL 419 + HWPSFYNVVTGKTLALPNL Sbjct: 4 ITIHWPSFYNVVTGKTLALPNL 25 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 47.6 bits (108), Expect = 4e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +2 Query: 314 GGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 46 GRQGDPLESTCRHASLALAVVLQRRDWENPGVTQL 80 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 47.6 bits (108), Expect = 4e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +3 Query: 354 LQFHWPSFYNVVTGKTLALPNL 419 + HWPSFYNVVTGKTLALPNL Sbjct: 4 ITIHWPSFYNVVTGKTLALPNL 25 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 47.6 bits (108), Expect = 4e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYPG 319 LSWVTPGFSQSRRCKTTAS +L++ ++ Y G Sbjct: 65 LSWVTPGFSQSRRCKTTAS---AKLSVMQVDYSG 95 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 47.6 bits (108), Expect = 4e-06 Identities = 25/41 (60%), Positives = 28/41 (68%), Gaps = 3/41 (7%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP---GPPSS 307 LSWVTPGFSQSRRCKTTAS + L + G P GP +S Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPLRWGPHAS 92 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 47.6 bits (108), Expect = 4e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +3 Query: 354 LQFHWPSFYNVVTGKTLALPNL 419 + HWPSFYNVVTGKTLALPNL Sbjct: 4 ITIHWPSFYNVVTGKTLALPNL 25 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 47.6 bits (108), Expect = 4e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +3 Query: 354 LQFHWPSFYNVVTGKTLALPNL 419 + HWPSFYNVVTGKTLALPNL Sbjct: 4 ITIHWPSFYNVVTGKTLALPNL 25 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 47.6 bits (108), Expect = 4e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +2 Query: 314 GGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 20 GEEGDPLESTCRHASLALAVVLQRRDWENPGVTQL 54 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 47.6 bits (108), Expect = 4e-06 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +3 Query: 360 FHWPSFYNVVTGKTLALPNL 419 +HWPSFYNVVTGKTLALPNL Sbjct: 61 WHWPSFYNVVTGKTLALPNL 80 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 47.6 bits (108), Expect = 4e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +3 Query: 354 LQFHWPSFYNVVTGKTLALPNL 419 + HWPSFYNVVTGKTLALPNL Sbjct: 82 ITIHWPSFYNVVTGKTLALPNL 103 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 47.6 bits (108), Expect = 4e-06 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +3 Query: 360 FHWPSFYNVVTGKTLALPNL 419 +HWPSFYNVVTGKTLALPNL Sbjct: 4 WHWPSFYNVVTGKTLALPNL 23 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 47.6 bits (108), Expect = 4e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +3 Query: 354 LQFHWPSFYNVVTGKTLALPNL 419 + HWPSFYNVVTGKTLALPNL Sbjct: 4 ITIHWPSFYNVVTGKTLALPNL 25 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 47.6 bits (108), Expect = 4e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +3 Query: 354 LQFHWPSFYNVVTGKTLALPNL 419 + HWPSFYNVVTGKTLALPNL Sbjct: 4 ITIHWPSFYNVVTGKTLALPNL 25 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 47.6 bits (108), Expect = 4e-06 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +3 Query: 360 FHWPSFYNVVTGKTLALPNL 419 +HWPSFYNVVTGKTLALPNL Sbjct: 56 WHWPSFYNVVTGKTLALPNL 75 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 175 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 207 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 396 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 428 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 47.2 bits (107), Expect = 6e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +2 Query: 314 GGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 20 GDLGDPLESTCRHASLALAVVLQRRDWENPGVTQL 54 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 98 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 130 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 679 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 711 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 185 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 217 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 47.2 bits (107), Expect = 6e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +2 Query: 314 GGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 40 GEGGDPLESTCRHASLALAVVLQRRDWENPGVTQL 74 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 237 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 269 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 47.2 bits (107), Expect = 6e-06 Identities = 21/37 (56%), Positives = 26/37 (70%) Frame = +2 Query: 308 LEGGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 +E G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 5 VEDKEGDPLESTCRHASLALAVVLQRRDWENPGVTQL 41 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 588 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 620 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 62 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 94 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 818 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 850 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 47.2 bits (107), Expect = 6e-06 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIG 337 LSWVTPGFSQSRRCKTTAS + L +G Sbjct: 479 LSWVTPGFSQSRRCKTTASAKLACLQVG 506 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 98 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 130 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 44 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 76 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 47.2 bits (107), Expect = 6e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASE 361 LSWVTPGFSQSRRCKTTASE Sbjct: 37 LSWVTPGFSQSRRCKTTASE 56 Score = 43.6 bits (98), Expect = 7e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +2 Query: 362 SLAVVLQRRDWENPGVTQL 418 SLAVVLQRRDWENPGVTQL Sbjct: 84 SLAVVLQRRDWENPGVTQL 102 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 331 NSPYSESYYN 360 NSPYSESYYN Sbjct: 74 NSPYSESYYN 83 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 325 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 357 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 139 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 171 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 49 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 81 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 11 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 43 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 23 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 55 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 47.2 bits (107), Expect = 6e-06 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = +2 Query: 311 EGGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 E G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 124 EAEEGDPLESTCRHASLALAVVLQRRDWENPGVTQL 159 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 44 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 76 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 47.2 bits (107), Expect = 6e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +2 Query: 314 GGPGYPIRPIVSRITISLAVVLQRRDWENPGVTQL 418 G G P+ +++LAVVLQRRDWENPGVTQL Sbjct: 70 GQHGDPLESTCRHASLALAVVLQRRDWENPGVTQL 104 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 515 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 547 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 123 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 155 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 83 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 115 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 85 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 117 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 79 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 111 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 184 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 216 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 44 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 76 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 221 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 253 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 157 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 189 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 84 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 116 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 52 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 47.2 bits (107), Expect = 6e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = -1 Query: 420 LSWVTPGFSQSRRCKTTASEIVIRLTIGRIGYP 322 LSWVTPGFSQSRRCKTTAS + L + G P Sbjct: 30 LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,354,276 Number of Sequences: 59808 Number of extensions: 117508 Number of successful extensions: 4608 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4599 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -